DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fisher-2008-1 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Fisher SH., Wray LV. DIP original experiment: DIP-68216X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bacillus subtilis glutamine synthetase regulates its own synthesis by acting as a chaperone to stabilize GlnR-DNA complexes. Fisher SH., Wray LV. Only protein-protein interactions imex curation fisher-2008-2 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Fisher SH., Wray LV. DIP original experiment: DIP-68217X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bacillus subtilis glutamine synthetase regulates its own synthesis by acting as a chaperone to stabilize GlnR-DNA complexes. Fisher SH., Wray LV. Only protein-protein interactions imex curation fisher-2008-3 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Fisher SH., Wray LV. DIP original experiment: DIP-68218X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bacillus subtilis glutamine synthetase regulates its own synthesis by acting as a chaperone to stabilize GlnR-DNA complexes. Fisher SH., Wray LV. Only protein-protein interactions imex curation glnr_bacsu HTH-type transcriptional regulator GlnR glnR BSU17450 protein protein bacsu Bacillus subtilis MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARSEGNRRLFSFHDVDKLLEIKHLIEQGVNMAGIKQILAKAEAEPEQKQNEKTKKPMKHDLSDDELRQLLKNELMQAGRFQRGNTFRQGDMSRFFH 5FF14F3BB2B1F1D7 gln1a_bacsu Glutamine synthetase Glutamine synthetase I alpha BSU17460 Glutamate--ammonia ligase glnA protein protein bacsu Bacillus subtilis MAKYTREDIEKLVKEENVKYIRLQFTDILGTIKNVEIPVSQLGKALDNKVMFDGSSIEGFVRIEESDMYLYPDLNTFVIFPWTAEKGKVARFICDIYNPDGTPFEGDPRNNLKRILKEMEDLGFSDFNLGPEPEFFLFKLDEKGEPTLELNDKGGYFDLAPTDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYAGAVRSCDDIQTFKLVVKTIARKHGLHATFMPKPLFGVNGSGMHCNLSLFKNGVNAFFDENADLQLSETAKHFIAGIVKHATSFTAVTNPTVNSYKRLVPGYEAPCYVAWSAQNRSPLIRIPASRGISTRVEVRSVDPAANPYLALSVLLAAGLDGIKNKLEAPAPIDRNIYVMSKEERMENGIVDLPATLAEALEEFKSNEVMVKALGEHLFEHFIEAKEIEWDMFRTQVHPWEREQYMSQY 83A5657CE1388AB0 glnr-1 3166342 N/A 3166345 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false glnr-gs-1 3166343 N/A 3166346 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3166345 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false glnr-gs-2 3166344 N/A 3166346 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3166345 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false