DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jnsson-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jönsson TJ., Johnson LC., Lowther WT. DIP original experiment: DIP-250325X Nature 2008 IMEx Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace. Jönsson TJ., Johnson LC., Lowther WT. Only protein-protein interactions imex curation jnsson-2008-2 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Jönsson TJ., Johnson LC., Lowther WT. DIP original experiment: DIP-250328X Nature 2008 IMEx Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace. Jönsson TJ., Johnson LC., Lowther WT. Only protein-protein interactions imex curation jnsson-2008-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jönsson TJ., Johnson LC., Lowther WT. DIP original experiment: DIP-250326X Nature 2008 IMEx Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace. Jönsson TJ., Johnson LC., Lowther WT. Only protein-protein interactions imex curation jnsson-2008-4 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Jönsson TJ., Johnson LC., Lowther WT. DIP original experiment: DIP-250327X Nature 2008 IMEx Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace. Jönsson TJ., Johnson LC., Lowther WT. Only protein-protein interactions imex curation prdx1_human Peroxiredoxin-1 PRDX1 PAGA PAGB TDPX2 Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Proliferation-associated gene protein Natural killer cell-enhancing factor A Thioredoxin-dependent peroxiredoxin 1 protein protein human Homo sapiens Human MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK srxn1_human Sulfiredoxin-1 SRXN1 C20orf139 SRX SRX1 protein protein human Homo sapiens Human MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ prdx1-srxn1-1 3166151 N/A 3166155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3166156 unspecified role unspecified role unspecified role unspecified role Region 32-137 Region 32-137 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prdx1-srxn1-2 3166152 N/A 3166155 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3166156 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prdx1-1 3166153 N/A 3166155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prdx1-srxn1-3 3166154 N/A 3166155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3166156 unspecified role unspecified role unspecified role unspecified role Region 32-137 Region 32-137 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false