DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ weiske-2007-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68737X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68731X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68735X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68732X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68736X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68734X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68738X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation weiske-2007-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68733X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Weiske J., Albring KF., Huber O. Only protein-protein interactions imex curation fhit_human Bis(5'-adenosyl)-triphosphatase Diadenosine 5',5'''-P1,P3-triphosphate hydrolase Dinucleosidetriphosphatase AP3A hydrolase Fragile histidine triad protein FHIT Adenosine 5'-monophosphoramidase FHIT Adenylylsulfatase Adenylylsulfate-ammonia adenylyltransferase protein protein human Homo sapiens Human MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI fhit-fhit-6 3165365 N/A 3165373 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165373 unspecified role unspecified role prey prey Binding region 74-147 Binding region 74-147 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false fhit-ctnnb1-1 3165366 N/A 3165374 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3165373 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ctnnb1-fhit-1 3165367 N/A 3165374 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3165373 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lef1-fhit-1 3165368 N/A 3165373 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3165375 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false ctnnb1-fhit-2 3165369 N/A 3165374 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3165373 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false lef1-ctnnb1-5 3165370 N/A 3165373 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3165375 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165374 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false lef1-ctnnb1-6 3165371 N/A 3165375 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165374 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false ctnnb1-fhit-3 3165372 N/A 3165374 unspecified role unspecified role bait bait Binding region 683-781 Binding region 683-781 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3165373 unspecified role unspecified role prey prey Binding region 1-75 Binding region 1-75 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false