IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pogge-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Immunity 2007 imex curation Only protein-protein interactions pogge-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de K562-derived cDNA library Immunity 2007 imex curation Only protein-protein interactions pogge-2007-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Immunity 2007 imex curation Only protein-protein interactions pogge-2007-4 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Immunity 2007 imex curation Only protein-protein interactions p46379-1 Large proline-rich protein BAG6 BAG6 BAG family molecular chaperone regulator 6 BAT3 BCL2-associated athanogene 6 G3 HLA-B-associated transcript 3 Protein G3 Protein Scythe protein protein human Homo sapiens Human MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP o14931-1 Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein 1C7a protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG ncr3-bag6-1 2969573 N/A 2969577 unspecified role unspecified role prey prey region_minus_BAG_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 2969578 unspecified role unspecified role bait bait signal sequence+ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp figure 1A bag6-bag6-1 2969573 N/A 2969577 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2969577 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2969588 2969586 physical association physical association false false false Supp figure 1A-2 ncr3-bag6-5 2969574 N/A 2969577 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2969578 unspecified role unspecified role bait bait signal sequence+ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2969593 2969591 physical association physical association false false false none ncr3-bag6-2 2969575 N/A 2969577 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2969578 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range false human IgG1 kappa signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 2969599 2969596 physical association physical association false false false Fig 1 ncr3-bag6-3 2969576 N/A 2969577 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2969578 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range false human IgG1 kappa signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2969607 2969604 physical association physical association false false false Fig 3 C/D/G Blocking of NKp30 by pp65 (UL83 -HCMV) did not interfere with BAT3 binding to plate-bound NKp30-Ig.