DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chattopadhyay-2007-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. DIP original experiment: DIP-68774X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function. Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. Only protein-protein interactions imex curation chattopadhyay-2007-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. DIP original experiment: DIP-68771X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function. Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. Only protein-protein interactions imex curation chattopadhyay-2007-3 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. DIP original experiment: DIP-68772X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function. Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. Only protein-protein interactions imex curation chattopadhyay-2007-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. DIP original experiment: DIP-68773X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function. Chattopadhyay K., Ramagopal UA., Mukhopadhaya A., Malashkevich VN., Dilorenzo TP., Brenowitz M., Nathenson SG., Almo SC. Only protein-protein interactions imex curation tnr18_human Tumor necrosis factor receptor superfamily member 18 TNFRSF18 AITR Activation-inducible TNFR family receptor GITR Glucocorticoid-induced TNFR-related protein UNQ319/PRO364 protein protein human Homo sapiens Human MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV tnf18_human Tumor necrosis factor ligand superfamily member 18 TNFSF18 AITRL GITRL TL6 UNQ149/PRO175 Activation-inducible TNF-related ligand Glucocorticoid-induced TNF-related ligand protein protein human Homo sapiens Human MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS tnfrsf18-tnfsf18-1 3164664 N/A 3164668 unspecified role unspecified role bait bait Region 30-155 Region 30-155 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3164669 unspecified role unspecified role prey prey Region 52-177 Region 52-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf18-1 3164665 N/A 3164669 unspecified role unspecified role unspecified role unspecified role Region 52-177 Region 52-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf18-2 3164666 N/A 3164669 unspecified role unspecified role unspecified role unspecified role Region 52-177 Region 52-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf18-3 3164667 N/A 3164669 unspecified role unspecified role unspecified role unspecified role Region 52-177 Region 52-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false