DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2007-18 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. DIP original experiment: DIP-261868X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Activation of tissue transglutaminase transcription by histone deacetylase inhibition as a therapeutic approach for Myc oncogenesis. Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. Only protein-protein interactions imex curation liu-2007-19 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. DIP original experiment: DIP-261870X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Activation of tissue transglutaminase transcription by histone deacetylase inhibition as a therapeutic approach for Myc oncogenesis. Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. Only protein-protein interactions imex curation liu-2007-20 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. DIP original experiment: DIP-261869X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Activation of tissue transglutaminase transcription by histone deacetylase inhibition as a therapeutic approach for Myc oncogenesis. Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. Only protein-protein interactions imex curation liu-2007-21 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. DIP original experiment: DIP-261871X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Activation of tissue transglutaminase transcription by histone deacetylase inhibition as a therapeutic approach for Myc oncogenesis. Liu T., Tee AE., Porro A., Smith SA., Dwarte T., Liu PY., Iraci N., Sekyere E., Haber M., Norris MD., Diolaiti D., Della Valle G., Perini G., Marshall GM. Only protein-protein interactions imex curation kat5_human Histone acetyltransferase KAT5 KAT5 TIP60 HTATIP Lysine acetyltransferase 5 cPLA(2)-interacting protein Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein human Homo sapiens Human MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW max_human Protein max MAX BHLHD4 Class D basic helix-loop-helix protein 4 Myc-associated factor X protein protein human Homo sapiens Human MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS sp1_human Transcription factor Sp1 SP1 TSFP1 protein protein human Homo sapiens Human MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF mycn_human N-myc proto-oncogene protein MYCN NMYC BHLHE37 Class E basic helix-loop-helix protein 37 protein protein human Homo sapiens Human MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA mycn_mouse N-myc proto-oncogene protein Mycn Nmyc Nmyc1 protein protein mouse Mus musculus Mouse MPSCTASTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRAFPEHSPEPSNWATEMLLPEADLWGNPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVNEKLQHGHGPPGVSSACSAPGVGASSPGGRALGGSSSASHTGATLPTDLSHPAAECVDPAVVFPFPVNKRESASVPAAPTSAPATSAAVTSVSVPATAPVAAPARAGGRPASSGEAKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNNKAVTTFTITVRPKTSALGLGRAQPGELILKRCVPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVVPAKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHALQANEHQLLLEKEKLQARQQQLLKKIEHARTC mycn-hdac1-1 3164279 N/A 3164283 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3164284 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3164285 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3164286 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3164287 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false mycn-hdac1-2 3164280 N/A 3164288 unspecified role unspecified role bait bait Region 336-462 Region 336-462 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3164287 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false hdac1-mycn-1 3164281 N/A 3164285 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3164286 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3164287 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false mycn-kat5-1 3164282 N/A 3164283 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3164288 unspecified role unspecified role bait bait Region 1-88 Region 1-88 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false