DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ declerck-2007-1 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. DIP original experiment: DIP-111321X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. Only protein-protein interactions imex curation declerck-2007-2 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. DIP original experiment: DIP-111322X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. Only protein-protein interactions imex curation declerck-2007-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. DIP original experiment: DIP-111323X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. Only protein-protein interactions imex curation plcr PlcR protein protein protein bactu Bacillus thuringiensis MQAEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNKISRLE papr5 PapR5 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LPFEF plcr-1 3164137 N/A 3164140 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papr5-plcr-1 3164138 N/A 3164141 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3164140 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papr5-plcr-2 3164139 N/A 3164141 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3164140 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false