DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dhaunchak-2007-1 mouse Mus musculus Mouse comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Dhaunchak AS., Nave KA. DIP original experiment: DIP-111356X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A common mechanism of PLP/DM20 misfolding causes cysteine-mediated endoplasmic reticulum retention in oligodendrocytes and Pelizaeus-Merzbacher disease. Dhaunchak AS., Nave KA. Only protein-protein interactions imex curation dhaunchak-2007-2 mouse Mus musculus Mouse comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Dhaunchak AS., Nave KA. DIP original experiment: DIP-111353X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.2e,f Dhaunchak AS., Nave KA. Only protein-protein interactions imex curation dhaunchak-2007-3 mouse Mus musculus Mouse comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Dhaunchak AS., Nave KA. DIP original experiment: DIP-111354X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A common mechanism of PLP/DM20 misfolding causes cysteine-mediated endoplasmic reticulum retention in oligodendrocytes and Pelizaeus-Merzbacher disease. Dhaunchak AS., Nave KA. Only protein-protein interactions imex curation dhaunchak-2007-4 mouse Mus musculus Mouse comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Dhaunchak AS., Nave KA. DIP original experiment: DIP-111355X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A common mechanism of PLP/DM20 misfolding causes cysteine-mediated endoplasmic reticulum retention in oligodendrocytes and Pelizaeus-Merzbacher disease. Dhaunchak AS., Nave KA. Only protein-protein interactions imex curation p60201-1 Myelin proteolipid protein PLP1 PLP Lipophilin protein protein human Homo sapiens Human MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF p60202-2 Myelin proteolipid protein Plp1 Plp Lipophilin protein protein mouse Mus musculus Mouse MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF p60202-1 Myelin proteolipid protein Plp1 Plp Lipophilin protein protein mouse Mus musculus Mouse MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF plp1-plp1-1 3163741 N/A 3163745 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse N/A 3163746 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association false false false plp1-1 3163742 N/A 3163745 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association false false false plp1-2 3163743 N/A 3163745 unspecified role unspecified role unspecified role unspecified role P60201-1:p.Cys220Tyr C219Y mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false plp1-plp1-2 3163744 N/A 3163746 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse N/A 3163747 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association false false false