DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kamsteeg-2007-1 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kamsteeg EJ., Duffield AS., Konings IB., Spencer J., Pagel P., Deen PM., Caplan MJ. DIP original experiment: DIP-111425X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx MAL decreases the internalization of the aquaporin-2 water channel. Kamsteeg EJ., Duffield AS., Konings IB., Spencer J., Pagel P., Deen PM., Caplan MJ. Only protein-protein interactions imex curation aqp2_rat Aquaporin-2 Aqp2 ADH water channel Aquaporin-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct protein protein rat Rattus norvegicus (Rat) Rat MWELRSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGILVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQAVTVELFLTMQLVLCIFASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAIIGSLLYNYLLFPSAKSLQERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGSKA mal_rat Myelin and lymphocyte protein Mal Mvp17 17 kDa myelin vesicular protein NS 3 T-lymphocyte maturation-associated protein protein protein rat Rattus norvegicus (Rat) Rat MAPAAASGGSTLPSGFSVFVTFPDLLFIFEFIFGGLVWILIASSLVPMPLVQGWVMFVSVFCFLATTSLMVMYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATITMFDGFTYRHYHENIAAVVFAYVATLLYVIHAVFSLIRWKSS mal-aqp2-1 3163220 N/A 3163221 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3163222 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false