DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ okamura-2007-1 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67964X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67971X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-3 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67970X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67977X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67969X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67963X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-7 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67978X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-8 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67972X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-9 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67962X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67975X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-11 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67967X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-12 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67974X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67960X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-14 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67966X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-15 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67973X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-16 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67965X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-17 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67968X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-18 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67961X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation okamura-2007-19 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67976X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions imex curation reg6_pyrho HTH-type transcriptional regulator FL11 fl11 Feast/famine regulatory protein FL11 PH1519 protein protein pyrho Pyrococcus horikoshii MRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPGVEGTHTMIVLKTHKETTELPIK FD7BD105608588E6 o73983_pyrho PHS023 protein protein pyrho Pyrococcus horikoshii MVTAFILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFITEKIRKMPEIQMTSTMIAI 67F8C97935354FC1 o74091_pyrho PHS045 protein protein pyrho Pyrococcus horikoshii MFILLVVRPGLENEVYEKLKDRPEVKEIYRLYGDYDIIIRLSVEGIKALDEFHDKVLRKLRGIEISETLIASSY D5B6AB9E85529E4F dm3 Hypothetical protein PH1856.1n protein protein pyrho Pyrococcus horikoshii q97c07_thevo TVG0307586 protein protein thevo thevo MSIAFVLISTVPGKEHEVYNKVLKINGVVEAHPLFGEYDIIVKLDMKDFTEIGEVVIEKIRTIDGVIDTKTLTGIKL E5BC84D7CAE7E464 q979l0_thevo TVG1179749 protein protein thevo thevo MDEKDRDILNLLIDNSRISNTEIAKVLNVSEGTVRKRIKKMIDEGIIKRFTVETSDNTIDALILVKIDNKKYKEVLQRLRARYYEIYEFSGRIDVAIRIKTDSTDNLNRIVDQIREIEGVVDTDTLIRLQ 8AF01E9937414AD9 o57938_pyrho HTH crp-type domain-containing protein PH0199 protein protein pyrho Pyrococcus horikoshii MTRERVELTNRQIELLRKLYREGKTIEVHTVEKTQDELAQELGITRQALSNHLKILKELGYIRTGRGFIDLTDKALELLGEKRGDVFIFVKIEPTKRKQVYDTIRKLRVKKIYRVTGDIDLIIEADKSKLDEILEEIAALDGVKETITHVVLGVL C6344E2395A9AC74 reg3_pyrho Uncharacterized HTH-type transcriptional regulator PH0140 PH0140 protein protein pyrho Pyrococcus horikoshii MITVPHSRKVELDEIDRAILRLLQEDGRMSYSEISRRINVPESTVRARVNRLVKEGVIRKFAALINPFKAGYEIVAFIAVDAEPAKVKQVVEELAKFPEVDVLGIVTGAHDIFMQVTVKDLQELERFILEKMAKIDGIKSTETSILTSVKKWGYARVF 8EBC6E37198BDB0D dm1-fl11-1 3163017 N/A 3163036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3163037 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm2-1 3163018 N/A 3163038 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm3-1 3163019 N/A 3163039 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tvdm-1 3163020 N/A 3163040 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm3-2 3163021 N/A 3163039 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm1-fl11-2 3163022 N/A 3163036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3163037 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tvdm-2 3163023 N/A 3163040 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm2-2 3163024 N/A 3163038 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm1-1 3163025 N/A 3163037 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tvfl3-1 3163026 N/A 3163041 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fl4-1 3163027 N/A 3163042 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fl5-1 3163028 N/A 3163043 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm1-2 3163029 N/A 3163037 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fl11-1 3163030 N/A 3163036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fl5-2 3163031 N/A 3163043 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fl11-2 3163032 N/A 3163036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fl4-2 3163033 N/A 3163042 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dm1-3 3163034 N/A 3163037 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tvfl3-2 3163035 N/A 3163041 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false