DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2007-32 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. DIP original experiment: DIP-111416X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for antiactivation in bacterial quorum sensing. Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. Only protein-protein interactions imex curation chen-2007-33 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. DIP original experiment: DIP-111419X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for antiactivation in bacterial quorum sensing. Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. Only protein-protein interactions imex curation chen-2007-34 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. DIP original experiment: DIP-111417X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx I guess that P1 and P2 not only form heterointeractions but homointeractions as well as determined by crystallography. Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. Only protein-protein interactions imex curation chen-2007-35 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. DIP original experiment: DIP-111418X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for antiactivation in bacterial quorum sensing. Chen G., Jeffrey PD., Fuqua C., Shi Y., Chen L. Only protein-protein interactions imex curation tram_sinfn Probable transcriptional repressor TraM traM y4dI NGR_a04080 protein protein rhisn Rhizobium sp. (strain NGR234) MNDMGSSEVNDENKEKEARYSVMTKSELEALAVSAIREHRRLLWADQAVYEEWLRASDDPSISGPVLQTLQDEYVARQKRSEAQQEELSDILDALGFVPDVPFDDDN trar_sinfn Probable transcriptional activator protein TraR traR y4dH NGR_a04090 protein protein rhisn Rhizobium sp. (strain NGR234) MSVNGNLRSLIDMLEAAQDGHMIKIALRSFAHSCGYDRFAYLQKDGTQVRTFHSYPGPWESIYLGSDYFNIDPVLAEAKRRRDVFFWTADAWPARGSSPLRRFRDEAISHGIRCGVTIPVEGSYGSAMMLTFASPERKVDISGVLDPKKAVQLLMMVHYQLKIIAAKTVLNPKQMLSPREMLCLVWASKGKTASVTANLTGINARTVQHYLDKARAKLDAESVPQLVAIAKDRGLV tram-trar-1 3162398 N/A 3162402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3162403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tram-trar-2 3162399 N/A 3162402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3162403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tram-trar-3 3162400 N/A 3162402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3162403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false trar-trar-1 3162401 N/A 3162403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3162403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false