DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kim-2007-33 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255106X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions imex curation kim-2007-34 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255110X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions imex curation kim-2007-35 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255108X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions imex curation kim-2007-36 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255109X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions imex curation kim-2007-37 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255107X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions imex curation ef1b_mouse Elongation factor 1-beta Eef1b Eef1b2 protein protein mouse Mus musculus Mouse MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIKSYEKEKASLPGVKKSLGKYGPSSVEDTTGSGAADAKDDDDIDLFGSDDEEESEEAKKLREERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI ef1a1_mouse Elongation factor 1-alpha 1 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Eef1a1 Eef1a protein protein mouse Mus musculus Mouse MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK k1c17_mouse Keratin, type I cytoskeletal 17 Krt17 Krt1-17 Keratin-17 Cytokeratin-17 protein protein mouse Mus musculus Mouse MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGSLGAGSCRLGSASGLGSALGSNSYSSCYSFGTGSGYGGNFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQKQAPGPARDYSAYYHTIEDLKNKILVATVDNASILLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR ef1g_mouse Elongation factor 1-gamma eEF-1B gamma Eef1g protein protein mouse Mus musculus Mouse MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGTFQHVGKAVNQGKIFK k1c17_human Keratin, type I cytoskeletal 17 KRT17 Cytokeratin-17 39.1 Keratin-17 protein protein human Homo sapiens Human MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR ef1g_human Elongation factor 1-gamma PRO1608 EEF1G EF1G eEF-1B gamma protein protein human Homo sapiens Human MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK eef1g-eef1a1-1 3162235 N/A 3162240 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3162241 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3162242 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3162243 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false krt17-eef1g-1 3162236 N/A 3162243 unspecified role unspecified role prey prey Region 185-223 Region 185-223 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3162244 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false krt17-eef1g-2 3162237 N/A 3162245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3162244 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false eef1g-krt17-1 3162238 N/A 3162245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3162244 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false krt17-eef1a1-1 3162239 N/A 3162240 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3162241 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3162242 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3162243 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false