DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ maillard-2007-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F. DIP original experiment: DIP-113472X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural diversity in twin-arginine signal peptide-binding proteins. Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F. Only protein-protein interactions imex curation maillard-2007-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F. DIP original experiment: DIP-113473X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural diversity in twin-arginine signal peptide-binding proteins. Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F. Only protein-protein interactions imex curation maillard-2007-3 bordetella pertussis Bordetella pertussis 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F. DIP original experiment: DIP-113474X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural diversity in twin-arginine signal peptide-binding proteins. Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F. Only protein-protein interactions imex curation napd_ecoli Chaperone NapD yojF napD b2207 JW2195 NapA signal peptide-binding chaperone NapD protein protein ecoli Escherichia coli (strain K12) MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP napa_ecoli Periplasmic nitrate reductase yojC yojD yojE napA b2206 JW2194 protein protein ecoli Escherichia coli (strain K12) MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQEAIKWDKAPCRFCGTGCGVLVGTQQGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMKNGKYDKEGEFTPITWDQAFDVMEEKFKTALKEKGPESIGMFGSGQWTIWEGYAASKLFKAGFRSNNIDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGANMAEMHPILWSRITNRRLSNQNVTVAVLSTYQHRSFELADNGIIFTPQSDLVILNYIANYIIQNNAINQDFFSKHVNLRKGATDIGYGLRPTHPLEKAAKNPGSDASEPMSFEDYKAFVAEYTLEKTAEMTGVPKDQLEQLAQLYADPNKKVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQPGCGPFSLTGQPSACGTAREVGTFAHRLPADMVVTNEKHRDICEKKWNIPSGTIPAKIGLHAVAQDRALKDGKLNVYWTMCTNNMQAGPNINEERMPGWRDPRNFIIVSDPYPTVSALAADLILPTAMWVEKEGAYGNAERRTQFWRQQVQAPGEAKSDLWQLVQFSRRFKTEEVWPEDLLAKKPELRGKTLYEVLYATPEVSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPVVNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV napa-napd-7 3162221 N/A 3162224 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3162225 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false napa-napd-8 3162222 N/A 3162224 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3162225 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false napa-napd-9 3162223 N/A 3162224 unspecified role unspecified role unspecified role unspecified role bordetella pertussis Bordetella pertussis N/A 3162225 unspecified role unspecified role unspecified role unspecified role bordetella pertussis Bordetella pertussis direct interaction direct interaction false false false