DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sanyal-2007-1 in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113444X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-2 in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113439X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx P1 + P2P1 + P3 Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-3 in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113446X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113442X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx confirmed with mammalian hybrid assay (dont know if it is appropriate in terms of DIP) Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113447X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113448X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113440X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx confirmed with mammalian hybrid assay (dont know if it is appropriate in terms of DIP) Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-8 in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113443X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-9 in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113445X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation sanyal-2007-10 in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113441X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx P1 + P2P1 + P3 Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions imex curation hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI gps2_human G protein pathway suppressor 2 GPS2 protein protein human Homo sapiens Human MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK nr0b2_human Nuclear receptor subfamily 0 group B member 2 NR0B2 SHP Orphan nuclear receptor SHP Small heterodimer partner protein protein human Homo sapiens Human MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR q9wv81_mouse Gps2 protein protein mouse Mus musculus Mouse MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLQEKLSALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTGHYVGSEAAFAGTPEHGQFQGSPGGVYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGSTLSLQKQMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQIQAAGKSGFATTSQPGPRLPFIQHSQNPRFYHK nr0b2_rat Nuclear receptor subfamily 0 group B member 2 Nr0b2 Shp Orphan nuclear receptor SHP Small heterodimer partner protein protein rat Rattus norvegicus (Rat) Rat MSSSQSGVCPCQGSASHPTILYTLLSPGPRTRPMAPASRSHCLCQQHRPVRLCAPHRTCREALDVLGKTVAFLRNLPSFCLLPHEDQRRLLEGCWGPLFLLGLAQDTVTFEVAEAPVPSILKKILLEEPNSGAQGAQPPDPPQPSLAAVQWLQHCLESFWSLELGPKEYAYLKGTILFNPDVPGLHASCHIAHLQQEAHWALCEVLEPWYPASQGRLARILLMASTLKNISCTLLVDLFFRPVIGDVDITELLEDMLLLR hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA q4qr41_xenla gps2.L LOC403370 gps2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPALLERPKLSNTMARALHRHVMMERERKRQEEEEVDKMMEQKLRDEQERRRKKEMEERMSLEETREQIMKLQDKLNSLQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLASAAYTQGMVMHTGAHLINMQGSPGGHSRNTSLMSDRAKQMFGPPVIAGRHYSSQTSFSPTAAEHGQYQSSPSSHGPYTVSQSQHSFAAGQAGPVNYAGSQPIRGPSAFQTMQYLSHQQPGYSMHSHYTGAHAGFMPTSTGIPLQKQLEHANQQSGFTDSSTLRPMHPQALQTLLPTPQITVPMQPAKSALSYSHPSRSASPGGYPHGTPPQQPHTSGFQASPQQNPRLPFMQHGQNQRFYHK 76479054EAF30620 gps2-hdac3-1 3162032 N/A 3162042 unspecified role unspecified role prey prey in vitro In vitro N/A 3162043 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false gps2-nr0b2-1 3162033 N/A 3162044 unspecified role unspecified role prey prey in vitro In vitro N/A 3162043 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false nr0b2-hdac3-1 3162034 N/A 3162042 unspecified role unspecified role prey prey in vitro In vitro N/A 3162044 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false nr0b2-gps2-1 3162035 N/A 3162045 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3162046 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false nr0b2-hdac1-1 3162036 N/A 3162042 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3162047 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3162044 unspecified role unspecified role bait bait HA HA ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false gps2-hdac1-1 3162037 N/A 3162043 unspecified role unspecified role bait bait Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3162042 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3162047 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false nr0b2-gps2 x-1 3162038 N/A 3162048 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3162046 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false gps2-hdac1-2 3162039 N/A 3162047 unspecified role unspecified role prey prey in vitro In vitro N/A 3162043 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false nr0b2-hdac1-2 3162040 N/A 3162047 unspecified role unspecified role prey prey in vitro In vitro N/A 3162044 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false gps2-nr0b2-2 3162041 N/A 3162046 unspecified role unspecified role prey prey in vitro In vitro N/A 3162043 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false