DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gngr-2007-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Güngör C., Taniguchi-Ishigaki N., Ma H., Drung A., Tursun B., Ostendorff HP., Bossenz M., Becker CG., Becker T., Bach I. DIP original experiment: DIP-113839X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Proteasomal selection of multiprotein complexes recruited by LIM homeodomain transcription factors. Güngör C., Taniguchi-Ishigaki N., Ma H., Drung A., Tursun B., Ostendorff HP., Bossenz M., Becker CG., Becker T., Bach I. Only protein-protein interactions imex curation gngr-2007-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Güngör C., Taniguchi-Ishigaki N., Ma H., Drung A., Tursun B., Ostendorff HP., Bossenz M., Becker CG., Becker T., Bach I. DIP original experiment: DIP-113840X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Proteasomal selection of multiprotein complexes recruited by LIM homeodomain transcription factors. Güngör C., Taniguchi-Ishigaki N., Ma H., Drung A., Tursun B., Ostendorff HP., Bossenz M., Becker CG., Becker T., Bach I. Only protein-protein interactions imex curation rnf12_mouse E3 ubiquitin-protein ligase RLIM Rlim Rnf12 LIM domain-interacting RING finger protein RING finger LIM domain-binding protein RING finger protein 12 RING-type E3 ubiquitin transferase RLIM protein protein mouse Mus musculus Mouse MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQSPDENRAGESSDDVTNSDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLSVENMESSSQRQMENSASESASARPSRAERNSAEAVTEVPTTRAQRRARSRSPEHRRTRARAERSRSPLQPTSEIPRRAPTLEQSSENEPEGSSRTRHHVTLRQQISGPELLGRGLFAASGSRNPSQGTSSSDTGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQAPNNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFMYSDSDSEPSASVSSRNVERVESRNGRGSSGGGNSSGSSSSSSPSPSSSGESSESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFDESGSLPFLSLAQFFLLNEDDEDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRESVV ldb2_mouse LIM domain-binding protein 2 Ldb2 Clim1 Carboxyl-terminal LIM domain-binding protein 1 LIM domain-binding factor CLIM1 protein protein mouse Mus musculus Mouse MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGSKKKTPAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENAPPQASQ not sure if in every case the origin is the same ssbp3_mouse Single-stranded DNA-binding protein 3 Ssbp3 Last Ssdp1 Sequence-specific single-stranded-DNA-binding protein Lck-associated signal transducer protein protein mouse Mus musculus Mouse MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV mint May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region rlim-ldb2-1 3161114 N/A 3161116 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3161117 unspecified role unspecified role prey prey Myc Myc myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false ldb2-rlim-1 3161115 N/A 3161118 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3161116 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3161117 unspecified role unspecified role bait bait 201-250 binding site 201-250 binding site required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse association association false false false