DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tamai-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113845X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113848X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113850X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113852X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113846X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113851X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113849X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation tamai-2007-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tamai TK., Young LC., Whitmore D. DIP original experiment: DIP-113847X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Light signaling to the zebrafish circadian clock by Cryptochrome 1a. Tamai TK., Young LC., Whitmore D. Only protein-protein interactions imex curation q9w6j4_danre clocka clock protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTSSIDRDDSSIFDGLMEEDEKDKAKRVSRNRSEKKRRDQFNVLIKELGTMLPGNTRKMDKSTILQKSIDFLRKHKEIAAQSESSEIRQDWKPPFLSNEEFTQLMLEALDGFFLAIMTDGNIIYVSESVTSLLEHLPSDLVDQNLLNFLPLGEHSEVYKALSTHMLEGETLTPDYLKTKNQLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNTVPNSTRNGFEGVIQRSLRHAFEDRVCFIATVRLAKPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLETLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAEQRRELGIEESPPEISADKSQDSGSESQLNTSSLKEALERFDHSRTPSASSRSSRKSSSHTAVSDPTSTQTKLQTDRSTPPRQSVSAIEMTSQRRSSISSQSMSSQTTGQTMGTSLVSQPQQPQTLQATVQPVLQFSTQMDAMQHLKEQLEQRTRMIEANIQRQQEELRQIQDELQRVQGQGLQMFLQPSGGGLNLSSVQLTQSSSVQTAGTLSMQGAVVPTATLQSSLQSTHSSTQHTVTQHPQQTAVQQQNLLRDQTTNLNQQSQRSTHTLQSPQGALPASLYNTMMISQPTQANVVQISTSLAQNSSTSGAAVDLLTKDPTDYRFPATQQLLTKLVTGPMACGAVMVPTTMFMGQVVTAFAPQQGQPQTISIAQQPSAQTADQQTHTQAQTQAAATAQQQGQNQAQLTQQQTQFLQAPRLLHSNQSTQLILQAAFPLQQQGTFTTATQQQQQLHQQQQQLQQQQQLQQQQQQQQQQLQQQHQQQQQQLQQQHQQQQQQLAAHRSDSMTERSNPPPQ q9i917_danre cry1a cry1aa zcry1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MVVNTVHWFRKGLRLHDNPSLRDSILGAHSVRCVYILDPWFAGSSNVGISRWRFLLQCLEDLDASLRKLNSRLFVIRGQPTDVFPRLFKEWNINRLSYEYDSEPFGKERDAAIKKLANEAGVEVIVRISHTLYDLDKIIELNGGQSPLTYKRFQTLISRMEAVVTPAETITAEVMGPCTTPLSDDHDEKFGVPSLEELGFDTEGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFHCYCPVSFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESVQKAAKCIIGVHYPMPMVHHAEASRLNIERMKQIYQQLSCYRGLGLLAMVPSNPNGSTMCYRQDAQQITGRGLHSSIIQTSGKRHSEESGPTTVSKVQRQCSS q9i879_danre arntl1a bmal1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MADQRMDISSTMNEFMSQSSADLISSSIGTTGMDYNRKRKGSTTEYQIDGFSFDDSMDTDKDKTLGRDEQQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVYKILNYTQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKMEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHPHIVPQPMNGDIRVKPTEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSFYEYFHQDDIGHLAECHRQVLQMREKISTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVSGSMLEGADPSYSQTASSPQSMDSVLTSGDGGGKRPLQIVPGIPGGTRAGAGKIGRMIAEEVMEIQRIRGSSPSSCGSSPLNITATPPPDTCSPGGKKIQNGGTPDLPSAGIVPGPDSIGYPYSNNSLMSDNSHLSIDIMEEPGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL q8jig1_danre arntl1b zfBMAL3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MADQRMDISSTMNEFMSPSSTELISSSMGSTGMDFNRKRKGSITDYEIDGFSFEDSMDTDKDKPLGRADQQMKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAANPYTEANYKPAFLSDDELKHLILKAADGFLFVVGCDRGKILFVSESVYKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVRTDIAPSPSRLCSGARRSFFCRMKCNRSMVKMEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHPHIVPQPVNGDIRVKPTEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSFYEYFHQDDIGHLAECHRQVLQMREKINTHCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVSGSSVDGAEPGFPQLSASPQSMDSVLTAADGSGKTVPGLPGGTRAGAGKIGRMIAEEVMEIHRIRGSSPSSCGSSPLNISNSTPPPDTSSPAARKMSNGGTPDIPSAGLGSGQDSIGYPYSNSSILSDNSHIGIGDIMDEPGSSSPSSDEAAMAIIMSLLEADAGLGGPVDFSDLPWPL q8jig2_danre clockb clock3 zfClock3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSSRDRDDGSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMDKSTILQKSIDYLRKNKENAAQSESSDIKQDWKPPFLSNEEFSQLMLEALDGFFLVMLTDGYIIYISESVTSLLEHLPSDLMDQNLLNFLPVVDHGEVYKALSSQPDIENLNSDYLKSKNQMEFCCHMLRGSVDPKKPPVYEYVKFIGNFKSLVNMPQKTRNGLEGILQHSLQPAFDDQLCFIATVRLAKPQFIKEMCMVEEPNEEFTSRHSLEWKFLLLDHRAPPIIGYMPFEVLGTSGYDYYHVDDLHSLAKCHEHLMQFGKGKSCYYRFLTKGQQWIWLQTNYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRREMGIEESPPELTADKKSGSETQLNNSLKKVLERFSDSRSPSTSSRSSHKSSHTAISDNTCTSTPSKLHMDVSSSPRPATVDMISQRRSSVSTQSMSSQNTTQTDSPVQISQQTQHQQPQQPQQVQPNALFSAQLNAMQHLKEQLEQRTRMIEANIQKQQEELRQIHEQLQRVQGPQMILQQPAQGGGPSVQLPQVGGAQNNILGIGTQASVVAIQGQNVTSTAHSGSAPQQQTLPQQQTPRSLQQNLQSSSVTQCGPVYNTMMISQPANANVVQIPSNLAPKISQANAINRFPAGQQLVTKIVTAPMACGAVMVPTSMFMGQVVTAYSPFTQQQGQTQTITLQTQPTVPADQQTQAATLQSQQQGATQQSTKQQQPFLQSTRLLHGNQPTQLILQAFPIQQQSTFTPSQQQQQQQVTETTHSETPETNGLLSSDGQR cry1aa-clocka-1 3160530 N/A 3160538 unspecified role unspecified role prey prey Binding region 236-390 Binding region 236-390 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160539 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false arntl1a-clocka-1 3160531 N/A 3160540 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160538 unspecified role unspecified role prey prey Binding region 236-390 Binding region 236-390 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Binding region 1-104 Binding region 1-104 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cry1aa-arntl1b-1 3160532 N/A 3160541 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160539 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cry1aa-arntl1a-1 3160533 N/A 3160539 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160540 unspecified role unspecified role prey prey Binding region 1-153 Binding region 1-153 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Binding region 445-626 Binding region 445-626 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false clocka-cry1aa-1 3160534 N/A 3160538 unspecified role unspecified role bait bait Binding region 236-390 Binding region 236-390 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160539 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false clocka-arntl1a-1 3160535 N/A 3160540 unspecified role unspecified role prey prey Binding region 1-153 Binding region 1-153 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Binding region 226-444 Binding region 226-444 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160538 unspecified role unspecified role bait bait Region 1-390 Region 1-390 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cry1aa-clockb-1 3160536 N/A 3160542 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160539 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false clocka-arntl1a-2 3160537 N/A 3160540 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3160538 unspecified role unspecified role bait bait Binding region 236-390 Binding region 236-390 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Binding region 1-104 Binding region 1-104 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false