DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jia-2007-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. DIP original experiment: DIP-253121X Nature 2007 IMEx Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation. Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. Only protein-protein interactions imex curation jia-2007-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. DIP original experiment: DIP-253119X Nature 2007 IMEx Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation. Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. Only protein-protein interactions imex curation jia-2007-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. DIP original experiment: DIP-253123X Nature 2007 IMEx Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation. Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. Only protein-protein interactions imex curation jia-2007-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. DIP original experiment: DIP-253124X Nature 2007 IMEx Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation. Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. Only protein-protein interactions imex curation jia-2007-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. DIP original experiment: DIP-253120X Nature 2007 IMEx Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation. Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. Only protein-protein interactions imex curation jia-2007-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. DIP original experiment: DIP-253122X Nature 2007 IMEx Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation. Jia D., Jurkowska RZ., Zhang X., Jeltsch A., Cheng X. Only protein-protein interactions imex curation dnm3l_mouse DNA (cytosine-5)-methyltransferase 3-like Dnmt3l protein protein mouse Mus musculus Mouse MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL o88508-1 DNA (cytosine-5)-methyltransferase 3A Cysteine methyltransferase DNMT3A Dnmt3a DNA methyltransferase MmuIIIA protein protein mouse Mus musculus Mouse MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKVGRPGRKRKHPPVESSDTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPAAGQKGGAPAEGEGTETPPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPACHDSDESDSGKAVEVQNKQMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV dnmt3a-dnmt3l-2 3160203 N/A 3160209 unspecified role unspecified role prey prey C-terminal domain Region 160-386 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3160210 unspecified role unspecified role bait bait C-terminal domain Region 623-908 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false dnmt3a-dnmt3l-3 3160204 N/A 3160209 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 160-386 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3160210 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 623-908 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmt3l-1 3160205 N/A 3160209 unspecified role unspecified role unspecified role unspecified role Q9CWR8:p.Phe297Ala F261A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmt3a-1 3160206 N/A 3160210 unspecified role unspecified role unspecified role unspecified role O88508-1:p.Phe728Ala F728A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 220-908 Region 220-908 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmt3a-dnmt3l-6 3160207 N/A 3160209 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 160-386 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3160210 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 623-908 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmt3l-dnmt3a-5 3160208 N/A 3160209 unspecified role unspecified role bait bait C-terminal domain Region 160-386 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3160210 unspecified role unspecified role prey prey C-terminal domain Region 623-908 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false