DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ santamara-2007-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santamaría D., Barrière C., Cerqueira A., Hunt S., Tardy C., Newton K., Cáceres JF., Dubus P., Malumbres M., Barbacid M. DIP original experiment: DIP-253139X Nature 2007 IMEx Cdk1 is sufficient to drive the mammalian cell cycle. Santamaría D., Barrière C., Cerqueira A., Hunt S., Tardy C., Newton K., Cáceres JF., Dubus P., Malumbres M., Barbacid M. Only protein-protein interactions imex curation santamara-2007-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santamaría D., Barrière C., Cerqueira A., Hunt S., Tardy C., Newton K., Cáceres JF., Dubus P., Malumbres M., Barbacid M. DIP original experiment: DIP-253140X Nature 2007 IMEx Cdk1 is sufficient to drive the mammalian cell cycle. Santamaría D., Barrière C., Cerqueira A., Hunt S., Tardy C., Newton K., Cáceres JF., Dubus P., Malumbres M., Barbacid M. Only protein-protein interactions imex curation santamara-2007-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Santamaría D., Barrière C., Cerqueira A., Hunt S., Tardy C., Newton K., Cáceres JF., Dubus P., Malumbres M., Barbacid M. DIP original experiment: DIP-253141X Nature 2007 IMEx Cdk1 is sufficient to drive the mammalian cell cycle. Santamaría D., Barrière C., Cerqueira A., Hunt S., Tardy C., Newton K., Cáceres JF., Dubus P., Malumbres M., Barbacid M. Only protein-protein interactions imex curation ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI cdk1_mouse Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 Cdk1 Cdc2a Cdc2 Cell division control protein 2 homolog Cdkn1 protein protein mouse Mus musculus Mouse MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM ccnd2_mouse G1/S-specific cyclin-D2 Ccnd2 Cyl-2 protein protein mouse Mus musculus Mouse MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVDCLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL ccne1_mouse G1/S-specific cyclin-E1 Ccne1 Ccne protein protein mouse Mus musculus Mouse MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE ccnd1-cdk1-1 3159943 N/A 3159946 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3159947 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false ccnd2-cdk1-1 3159944 N/A 3159948 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3159947 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false ccne1-cdk1-1 3159945 N/A 3159949 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3159947 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false