DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bai-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113955X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113950X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113952X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-4 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113951X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113953X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113958X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113959X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113956X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113957X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation bai-2007-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113954X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions imex curation 14335_orysj 14-3-3-like protein GF14-E G-box factor 14-3-3 homolog E GF14E B1267B06.30-1 OJ1115_A05.5-1 OsJ_07268 LOC_Os02g36974 Os02g0580300 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSQPAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDRCTLIKEYRGKIETELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDAAEEIKEAPKGESGDGQ bzr1_orysj Protein BZR1 homolog 1 BZR1 Protein BRASSINAZOLE-RESISTANT 1 homolog 1 OsJ_24880 P0453G03.22 LOC_Os07g39220 Os07g0580500 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK 14331_orysj 14-3-3-like protein GF14-A G-box factor 14-3-3 homolog A GF14A OJ1113_A10.40 OSJNBb0092C08.10 Os08g0480800 LOC_Os08g37490 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAAAAGGGTREEMVYMAKLAEQAERYEEMVEFMEKVVTAAAAGGGGELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGAAGHAAAARSYRARVEAELSNICAGILRLLDERLVPAAAAVDAKVFYLKMKGDYHRYLAEFKTGAERKDAADATLAAYQAAQDIAMKELSPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDATKPEDEH 14332_orysj 14-3-3-like protein GF14-B GF14B G-box factor 14-3-3 homolog B B0812A04.1 B1358B12.12 OSJNBa0072F16.20 Os04g0462500 LOC_Os04g38870 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSAQAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDTAEEIREAPKRDSSEGQ 14333_orysj 14-3-3-like protein GF14-C GF14C G-box factor 14-3-3 homolog C OJ1124_B05.7 Os08g0430500 LOC_Os08g33370 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSREENVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGNEEHVTLIKEYRGKIEAELSKICDGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGDACEGQ 14338_orysj Putative 14-3-3-like protein GF14-H GF14H G-box factor 14-3-3 homolog H LOC_Os11g39540 Os11g0609600 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MKEREKVVRLAKLAEQAERYDDMVEFMKTLARMDVDMSAEERLLFSVGFKKTIGARRASWRILESLEQKVTAGDQPGVTINGYKKKVEDELRAVCNEVLSIIAIHCLPLANSGENVVFFYKMKGDYYRYLAEFSTGTEKKAATDQSLMAYQAWPCAQLFSLLEIMNSPERASQVAKQALDEATAEINSAGVEGYKDSMLMMQLLKENLALWTSELTGGETSKDDDVVMEG 14336_orysj 14-3-3-like protein GF14-F G-box factor 14-3-3 homolog F OsGF14a 14-3-3-like protein S94 Stress-regulated 14-3-3 protein GF14F OsJ_12311 LOC_Os03g50290 Os03g0710800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSPAEASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQDIALADLPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGEGH 14337_orysj 14-3-3-like protein GF14-G GF14G G-box factor 14-3-3 homolog G OSJNBa0016I09.32 LOC_Os01g11110 Os01g0209200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAPSDDLVYMAKLAEQAERYDEMVEAMNSVAKLDEGLTKEERNLLSVGYKNLIGAKRAAMRIIGSIELKEETKGKESHVRQTAEYRRKVEAEMDKICCDVINIIDKYLIPHSSGAESSVFYYKMKGDYYRYLAEFKTGTEKIEVSELSLNAYETASKTAQTDLTPTDPIRLGLALNISVFYCEIMNSPDKACQLAKNAFDEAVAELPSLSEENYKDSTLIMQLLRDNLALWNSDMADDADDIRERTDTTGAKGDPAA 14334_orysj 14-3-3-like protein GF14-D GF14D G-box factor 14-3-3 homolog D OsJ_34200 LOC_Os11g34450 Os11g0546900 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSPAEPTREESVYKAKLAEQAERYEEMVEYMERVARAAGGASGGEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNDAHAATIRSYRGKIEAELARICDGILALLDSHLVPSAGAAESKVFYLKMKGDYHRYLAEFKSGDERKQAAESTMNAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDANDDGGDEIKEAAAPKEPGDQ bzr1-gf14e-1 3159886 N/A 3159896 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14a-1 3159887 N/A 3159898 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14b-1 3159888 N/A 3159899 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14c-1 3159889 N/A 3159900 unspecified role unspecified role unspecified role unspecified role C-terminal of CFP C-terminal of CFP cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3159897 unspecified role unspecified role unspecified role unspecified role Q7XI96:p.Ser156Gly S156G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N-terminal of YFP N-terminal of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana direct interaction direct interaction false false false bzr1-gf14c-2 3159890 N/A 3159900 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14h-1 3159891 N/A 3159901 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14c-3 3159892 N/A 3159900 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait Q7XI96:p.Ser156Gly S156G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14f-1 3159893 N/A 3159902 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14g-1 3159894 N/A 3159903 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bzr1-gf14d-1 3159895 N/A 3159904 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159897 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false