DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lan-2007-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253165X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253172X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253169X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253167X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-9 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253171X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-10 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253166X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-11 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253173X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-12 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253170X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation lan-2007-13 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. DIP original experiment: DIP-253168X Nature 2007 IMEx Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan F., Collins RE., De Cegli R., Alpatov R., Horton JR., Shi X., Gozani O., Cheng X., Shi Y. Only protein-protein interactions imex curation pf21a_human PHD finger protein 21A BRAF35-HDAC complex protein BHC80 BHC80a PHF21A BHC80 KIAA1696 BM-006 protein protein human Homo sapiens Human MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEKQKRVVEQLRKNLIVKQEQPDKFQIQPLPQSENKLQTAQQQPLQQLQQQQQYHHHHAQQSAAASPNLTASQKTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTLVQATPPQPIKVPQFIPPPRLTPRPNFLPQVRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLAGPQTVQLSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK rcor1_human REST corepressor 1 RCOR1 KIAA0071 RCOR Protein CoREST protein protein human Homo sapiens Human MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA o60341-1 Lysine-specific histone demethylase 1A KDM1A AOF2 KDM1 KIAA0601 LSD1 BRAF35-HDAC complex protein BHC110 Flavin-containing amine oxidase domain-containing protein 2 [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A protein protein human Homo sapiens Human MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM q96bd5-1 PHD finger protein 21A PHF21A BHC80 KIAA1696 BM-006 BHC80a BRAF35-HDAC complex protein BHC80 protein protein human Homo sapiens Human MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEKQKRVVEQLRKNLIVKQEQPDKFQIQPLPQSENKLQTAQQQPLQQLQQQQQYHHHHAQQSAAASPNLTASQKTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTLVQATPPQPIKVPQFIPPPRLTPRPNFLPQVRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLAGPQTVQLSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA kdm1a-hdac1-3 3159536 N/A 3159545 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159546 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159547 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159548 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false h3(121)-phf21a-1 3159537 N/A 3159549 unspecified role unspecified role unspecified role unspecified role PHD domain Region 486-543 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3159550 unspecified role unspecified role unspecified role unspecified role K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h3(121)-phf21a-2 3159538 N/A 3159545 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159550 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false h3(121)-phf21a-3 3159539 N/A 3159549 unspecified role unspecified role unspecified role unspecified role PHD domain Region 486-543 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3159550 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h3(121)-phf21a-4 3159540 N/A 3159549 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false PHD domain Region 486-543 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3159550 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h3(121)-kdm1a-1 3159541 N/A 3159545 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3159550 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro N/A 3159548 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false h3(121)-kdm1a-2 3159542 N/A 3159548 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3159549 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3159550 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false in vitro In vitro association association false false false h3(121)-phf21a-5 3159543 N/A 3159549 unspecified role unspecified role prey prey Region 486-532 Region 486-532 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false PHD domain Region 486-543 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q96BD5-1:p.Asp489Ala D489A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q96BD5-1:p.Met502Trp M502W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3159550 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro direct interaction direct interaction false false false h3(121)-phf21a-6 3159544 N/A 3159549 unspecified role unspecified role prey prey PHD domain Region 486-543 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3159550 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false