DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ manavathi-2007-1 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113967X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation manavathi-2007-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113970X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation manavathi-2007-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113972X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation manavathi-2007-4 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113968X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation manavathi-2007-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113971X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation manavathi-2007-6 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113973X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation manavathi-2007-7 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. DIP original experiment: DIP-113969X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Repression of Six3 by a corepressor regulates rhodopsin expression. Manavathi B., Peng S., Rayala SK., Talukder AH., Wang MH., Wang RA., Balasenthil S., Agarwal N., Frishman LJ., Kumar R. Only protein-protein interactions imex curation q9et75_rat Six3 protein protein rat Rattus norvegicus (Rat) Rat MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGAGGGGGAGGGGGGGGGNRAGGGGAGGAGGGGGGGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV mta1_rat Metastasis-associated protein MTA1 Mta1 Zg29 protein protein rat Rattus norvegicus (Rat) Rat MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSSLIALADKHATLSVCYRAGPGADTGEEGEVEEEVENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKDGEEDGRDQSKLETKVWEAHNPLVDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNSVKASVVNGTGTPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRNNMSPHGIPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYMPINSAAIKAECTARLPEASQSPLVLKQVVRKPLEAVLRYLETHPRPPKPDPVKSSSSVLSSLTPAKSAPVINNGSPTILGKRSYEQHNGVDGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP six3_mouse Homeobox protein SIX3 Six3 Sine oculis homeobox homolog 3 protein protein mouse Mus musculus Mouse MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGASGGGGGAGGGGGGNRAGGGGAGGAGGGSGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV q99pa1_rat protein protein rat Rattus norvegicus (Rat) Rat YETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKEAEDKKTDVKEEDKSKDNSGEKTDTKGAKSEQLNNP mta1_mouse Metastasis-associated protein MTA1 Mta1 protein protein mouse Mus musculus Mouse MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSSLIALADKHATLSVCYRAGPGADTGEEGEVEEEVENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSKLETKVWEAHNPLVDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISASSVKATVVNGTGTPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRNNMSPHGIPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYMPINSAAIKAECTARLPEASQSPLVLKQVVRKPLEAVLRYLETHPRPPKPDPVKSSSSVLSSLTPAKSAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED mta1-six3-1 3159295 N/A 3159302 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3159303 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false hdac2-six3-1 3159296 N/A 3159304 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3159305 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false hdac2-six3-2 3159297 N/A 3159304 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3159305 unspecified role unspecified role prey prey 120-333 120-333 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hdac2-six3-3 3159298 N/A 3159306 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3159302 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false mta1-six3-2 3159299 N/A 3159307 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3159305 unspecified role unspecified role prey prey 184 - 333 184 - 333 required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mta1-six3-3 3159300 N/A 3159303 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3159302 unspecified role unspecified role prey prey flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rat Rattus norvegicus (Rat) Rat physical association physical association false false false mta1-six3-4 3159301 N/A 3159305 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3159307 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false