DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chang-2007-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chang YP., Wang G., Bermudez V., Hurwitz J., Chen XS. DIP original experiment: DIP-113982X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the GINS complex and functional insights into its role in DNA replication. Chang YP., Wang G., Bermudez V., Hurwitz J., Chen XS. Only protein-protein interactions imex curation chang-2007-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chang YP., Wang G., Bermudez V., Hurwitz J., Chen XS. DIP original experiment: DIP-113984X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the GINS complex and functional insights into its role in DNA replication. Chang YP., Wang G., Bermudez V., Hurwitz J., Chen XS. Only protein-protein interactions imex curation chang-2007-8 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Chang YP., Wang G., Bermudez V., Hurwitz J., Chen XS. DIP original experiment: DIP-113983X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the GINS complex and functional insights into its role in DNA replication. Chang YP., Wang G., Bermudez V., Hurwitz J., Chen XS. Only protein-protein interactions imex curation psf3_human DNA replication complex GINS protein PSF3 GINS3 PSF3 GINS complex subunit 3 protein protein human Homo sapiens Human MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED psf2_human DNA replication complex GINS protein PSF2 GINS complex subunit 2 GINS2 CGI-122 DC5 HSPC037 PSF2 protein protein human Homo sapiens Human MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF sld5_human DNA replication complex GINS protein SLD5 SLD5 GINS complex subunit 4 GINS4 protein protein human Homo sapiens Human MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI psf1_human DNA replication complex GINS protein PSF1 GINS1 GINS complex subunit 1 KIAA0186 PSF1 protein protein human Homo sapiens Human MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS gins1-gins2-4 3159244 N/A 3159247 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159248 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159249 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159250 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false gins1-gins2-5 3159245 N/A 3159247 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159248 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159249 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159250 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false gins1-gins2-6 3159246 N/A 3159247 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159248 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159249 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159250 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false