DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chini-2007-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253142X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-2 in vitro In vitro pull down pull down autoradiography autoradiography Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253144X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253146X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-4 in vitro In vitro pull down pull down autoradiography autoradiography Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253148X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-5 in vitro In vitro pull down pull down autoradiography autoradiography Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253143X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253145X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-7 in vitro In vitro pull down pull down autoradiography autoradiography Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253147X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation chini-2007-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. DIP original experiment: DIP-253149X Nature 2007 IMEx The JAZ family of repressors is the missing link in jasmonate signalling. Chini A., Fonseca S., Fernández G., Adie B., Chico JM., Lorenzo O., García-Casado G., López-Vidriero I., Lozano FM., Ponce MR., Micol JL., Solano R. Only protein-protein interactions imex curation coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT myc2_arath Transcription factor MYC2 MYC2 BHLH6 Basic helix-loop-helix protein 6 EN38 JAI1 JIN1 Protein JASMONATE INSENSITIVE 1 R-homologous Arabidopsis protein 1 RAP1 RD22BP1 Transcription factor EN 38 Z-box binding factor 1 protein ZBF1 bHLH transcription factor bHLH006 rd22BP1 F6N18.4 At1g32640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSSPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSSDLINKVRILFNFDGGAGDLSGLNWNLDPDQGENDPSMWINDPIGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSTSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSGQTQFENKRKRSMVLNEDKVLSFGDKTAGESDHSDLEASVVKEVAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI coi1-tify6b-1 3159064 N/A 3159072 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3159073 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false tify6b-myc2-2 3159065 N/A 3159074 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3159073 unspecified role unspecified role bait bait C-terminal domain Region 208-352 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false tify6b-myc2-3 3159066 N/A 3159074 unspecified role unspecified role prey prey N-terminal domain Region 1-333 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3159073 unspecified role unspecified role bait bait C-terminal domain Region 208-352 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false myc2-tify10a-2 3159067 N/A 3159075 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3159074 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false tify6b-coi1-1 3159068 N/A 3159072 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3159073 unspecified role unspecified role bait bait N-terminal domain Region 1-298 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false myc2-tify6b-1 3159069 N/A 3159074 unspecified role unspecified role bait bait N-terminal domain Region 1-333 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3159073 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false coi1-tify10a-1 3159070 N/A 3159075 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3159072 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false myc2-tify6b-2 3159071 N/A 3159074 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3159073 unspecified role unspecified role prey prey C-terminal domain Region 208-352 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false