DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hagelueken-2007-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hagelueken G., Wiehlmann L., Adams TM., Kolmar H., Heinz DW., Tümmler B., Schubert WD. DIP original experiment: DIP-114000X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the electron transfer complex rubredoxin rubredoxin reductase of Pseudomonas aeruginosa. Hagelueken G., Wiehlmann L., Adams TM., Kolmar H., Heinz DW., Tümmler B., Schubert WD. Only protein-protein interactions imex curation hagelueken-2007-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hagelueken G., Wiehlmann L., Adams TM., Kolmar H., Heinz DW., Tümmler B., Schubert WD. DIP original experiment: DIP-114001X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the electron transfer complex rubredoxin rubredoxin reductase of Pseudomonas aeruginosa. Hagelueken G., Wiehlmann L., Adams TM., Kolmar H., Heinz DW., Tümmler B., Schubert WD. Only protein-protein interactions imex curation hagelueken-2007-3 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Hagelueken G., Wiehlmann L., Adams TM., Kolmar H., Heinz DW., Tümmler B., Schubert WD. DIP original experiment: DIP-114002X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the electron transfer complex rubredoxin rubredoxin reductase of Pseudomonas aeruginosa. Hagelueken G., Wiehlmann L., Adams TM., Kolmar H., Heinz DW., Tümmler B., Schubert WD. Only protein-protein interactions imex curation rure_pseae Rubredoxin-NAD(+) reductase alkT PA5349 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSERAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA C98EA1FC3E15FA8F rubr2_pseae Rubredoxin-2 rubA2 alkG2 PA5350 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MRKWQCVVCGFIYDEALGLPEEGIPAGTRWEDIPADWVCPDCGVGKIDFEMIEIA 9C27F01DAB7E49C6 rdxr-1 3158908 N/A 3158911 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rdx-rdxr-1 3158909 N/A 3158912 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158911 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rdx-rdxr-2 3158910 N/A 3158912 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158911 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false