DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ago-2007-1 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ago H., Kanaoka Y., Irikura D., Lam BK., Shimamura T., Austen KF., Miyano M. DIP original experiment: DIP-253175X Nature 2007 IMEx Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis. Ago H., Kanaoka Y., Irikura D., Lam BK., Shimamura T., Austen KF., Miyano M. Only protein-protein interactions imex curation ago-2007-2 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ago H., Kanaoka Y., Irikura D., Lam BK., Shimamura T., Austen KF., Miyano M. DIP original experiment: DIP-253176X Nature 2007 IMEx Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis. Ago H., Kanaoka Y., Irikura D., Lam BK., Shimamura T., Austen KF., Miyano M. Only protein-protein interactions imex curation ltc4s_human Leukotriene C4 synthase LTC4S Leukotriene-C(4) synthase Glutathione S-transferase LTC4 Leukotriene-C4 synthase protein protein human Homo sapiens Human MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA ltc4s-3 3158867 N/A 3158869 unspecified role unspecified role unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast direct interaction direct interaction false false false ltc4s-4 3158868 N/A 3158869 unspecified role unspecified role unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast direct interaction direct interaction false false false