DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hockemeyer-2007-1 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68074X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-2 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68077X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-3 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68073X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-4 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68076X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-5 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68072X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-6 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68079X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-7 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68075X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation hockemeyer-2007-8 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. DIP original experiment: DIP-68078X Nature structural & molecular biology 2007 IMEx Telomere protection by mammalian Pot1 requires interaction with Tpp1. Hockemeyer D., Palm W., Else T., Daniels JP., Takai KK., Ye JZ., Keegan CE., de Lange T., Hammer GD. Only protein-protein interactions imex curation pote1_mouse Protection of telomeres protein 1 Pot1 Pot1a POT1-like telomere end-binding protein protein protein mouse Mus musculus Mouse MSLVSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGTSYGRGIRVLPDTSPCVDQLKKALEGANLPVTETSTGICQSENGDSSALSNSGSGAVSPYEEERCQQVSATILTNHQHLEKTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSVQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTEDQGGRQVAVHFVKNNGILPASSECLILIEGGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYGCKQCSSLKPIQNLNSRFHKGPWTPSSVAEALGVVPLQYVFVMVFTLDDGTGVLEAYLKDSEHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVDAYPWLECLLKSYNVTIGTERRICYQIFDTTVAENVV mint Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity q5ee38-1 Adrenocortical dysplasia protein Acd protein protein mouse Mus musculus Mouse MSDSGLLALQPWIRELILGSETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVTRNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLLDEVREDQDHRGALVCLAKSCLVLKGPCTTTPLTDWITSGSQALGKAVFTVSGSLLHIPEGEEQILSSTGSSQKARGTSASPSHMPLEESGASVSLLSALATSDPGQMDSSQSPPAVGSTSPRAQAPTSPPCNSTPSSLLLNCSPSLSPLHPAPRSHQSCETRAQAPKLEFQCSFKKRQLLPRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVAWALNIVMESESELTQV acd_human Adrenocortical dysplasia protein homolog POT1 and TIN2-interacting protein ACD PIP1 PTOP TINT1 TPP1 protein protein human Homo sapiens Human MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLTLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPSSSGTPALPGHMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQAVRLPPQLMAWALHFLMDAQPGSEPTPM q3tns5_mouse Protection of telomeres protein 1 Pot1b protein protein mouse Mus musculus Mouse MSSAPVAPSTYTPLNLLKEGTVVNVCGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCMLFSRDYDTLPSVYKVGDIVCFQGLKIQAYKNELQAISKFGFASLTFDGTLGAPIILRTLSKRFNFTAQDYSMVEALRTWASTHISASSNLVQLSDAQPMQYYDLTCQLLGKAQVDGVSFLLKVWDGTRTKIPSWRVCIQDVAFEGDLSHILQLQNLVVDIVVYDNHVQVAKSLKIGSFLRIYSLHTKLQPINSESTTSLVRLEFHLHGGTSYGRGIRVLPESNYDVDQLKKALESVDLEAIQTSDDTYQSDNVENCLTSSSSESDLVSLYEVERCQPLCATTLTGYHHLEKTSLCDILKQRAPRQYRIRAKLRSYKPRRLPQSVKLFCPKCHLLQEIPSEENVDKILQDATATAPDCKLQDTPLYDSEVWTTEGQGGRQVAVHFVKNDGVLPHSSECLVLIEGGRLCEISRLSSMFHSVIPVRSGPEDLELVDLAAPFLIRGKVCHYGCKQCSNLKTIQNLSIIPNKRLWIPSSVAEVLGIVPLQYVFVMTFMFDDGTGVLDVYLKDSEKFFQIPASEVLTDDDLQRNLEQIMNVICPPGIKIGRQHFKGASFSSLKIHLVCI q9nux5-1 Protection of telomeres protein 1 POT1 POT1-like telomere end-binding protein Variant 1 protein protein human Homo sapiens Human MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTANQHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI pot1-acd-2 3158802 N/A 3158810 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3158811 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false pot1-acd-3 3158803 N/A 3158810 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3158812 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false acd-pot1b-1 3158804 N/A 3158811 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3158813 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false pot1-acd-4 3158805 N/A 3158811 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3158814 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false acd-pot1-8 3158806 N/A 3158810 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3158811 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false pot1-acd-5 3158807 N/A 3158812 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3158814 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false pot1b-acd-2 3158808 N/A 3158811 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3158813 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false pot1b-acd-3 3158809 N/A 3158812 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3158813 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false