DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ white-2007-5 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261775X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions imex curation white-2007-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261772X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions imex curation white-2007-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261773X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions imex curation white-2007-8 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261774X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions imex curation neut_human Neurotensin/neuromedin N NTS protein protein human Homo sapiens Human MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY ntr1_human Neurotensin receptor type 1 NTSR1 NTRR High-affinity levocabastine-insensitive neurotensin receptor NTRH protein protein human Homo sapiens Human MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY nts-ntsr1-1 3158638 N/A 3158642 unspecified role unspecified role unspecified role unspecified role Region 151-163 Region 151-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3158643 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nts-ntsr1-2 3158639 N/A 3158642 unspecified role unspecified role unspecified role unspecified role Region 151-163 Region 151-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3158643 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ntsr1-1 3158640 N/A 3158643 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ntsr1-2 3158641 N/A 3158643 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false