DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cho-2007-15 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cho US., Morrone S., Sablina AA., Arroyo JD., Hahn WC., Xu W. DIP original experiment: DIP-66877X PLoS biology 2007 IMEx Structural basis of PP2A inhibition by small t antigen. Cho US., Morrone S., Sablina AA., Arroyo JD., Hahn WC., Xu W. Only protein-protein interactions imex curation cho-2007-16 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cho US., Morrone S., Sablina AA., Arroyo JD., Hahn WC., Xu W. DIP original experiment: DIP-66878X PLoS biology 2007 IMEx Structural basis of PP2A inhibition by small t antigen. Cho US., Morrone S., Sablina AA., Arroyo JD., Hahn WC., Xu W. Only protein-protein interactions imex curation 2aaa_mouse Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform Ppp2r1a PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha protein protein mouse Mus musculus Mouse MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA o56327_sv40 Small t antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEVFASSLNPGVDAIYCKQWPECAKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDLKL 8B5D3944634EE66D ppp2r1a-st-4 3158489 N/A 3158491 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158492 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ppp2r1a-st-5 3158490 N/A 3158491 unspecified role unspecified role bait bait Q76MZ3:p.Glu216Ala E216A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q76MZ3:p.Gln217Ala Q217A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3158492 unspecified role unspecified role prey prey O56327:p.Arg7Ala R7A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O56327:p.Arg21Ala R21A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O56327:p.Pro132Ala P132A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false