DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mitchell-2007-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. DIP original experiment: DIP-261731X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Thioredoxin is required for S-nitrosation of procaspase-3 and the inhibition of apoptosis in Jurkat cells. Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. Only protein-protein interactions imex curation mitchell-2007-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. DIP original experiment: DIP-261734X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Thioredoxin is required for S-nitrosation of procaspase-3 and the inhibition of apoptosis in Jurkat cells. Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. Only protein-protein interactions imex curation mitchell-2007-3 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. DIP original experiment: DIP-261736X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Thioredoxin is required for S-nitrosation of procaspase-3 and the inhibition of apoptosis in Jurkat cells. Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. Only protein-protein interactions imex curation mitchell-2007-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. DIP original experiment: DIP-261732X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Thioredoxin is required for S-nitrosation of procaspase-3 and the inhibition of apoptosis in Jurkat cells. Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. Only protein-protein interactions imex curation mitchell-2007-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. DIP original experiment: DIP-261735X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Thioredoxin is required for S-nitrosation of procaspase-3 and the inhibition of apoptosis in Jurkat cells. Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. Only protein-protein interactions imex curation mitchell-2007-6 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. DIP original experiment: DIP-261733X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Thioredoxin is required for S-nitrosation of procaspase-3 and the inhibition of apoptosis in Jurkat cells. Mitchell DA., Morton SU., Fernhoff NB., Marletta MA. Only protein-protein interactions imex curation casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV txn-casp3-1 3158345 N/A 3158351 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3158352 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false casp3-txn-1 3158346 N/A 3158351 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158352 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false casp3-txn-2 3158347 N/A 3158351 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3158352 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage false false false casp3-txn-3 3158348 N/A 3158351 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3158352 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false txn-casp3-2 3158349 N/A 3158351 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3158352 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false casp3-txn-4 3158350 N/A 3158351 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3158352 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false