DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ boguslavsky-2007-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. DIP original experiment: DIP-261643X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin. Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. Only protein-protein interactions imex curation boguslavsky-2007-2 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. DIP original experiment: DIP-261646X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin. Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. Only protein-protein interactions imex curation boguslavsky-2007-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. DIP original experiment: DIP-261648X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin. Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. Only protein-protein interactions imex curation boguslavsky-2007-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. DIP original experiment: DIP-261644X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin. Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. Only protein-protein interactions imex curation boguslavsky-2007-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. DIP original experiment: DIP-261647X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin. Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. Only protein-protein interactions imex curation boguslavsky-2007-6 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. DIP original experiment: DIP-261645X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin. Boguslavsky S., Grosheva I., Landau E., Shtutman M., Cohen M., Arnold K., Feinstein E., Geiger B., Bershadsky A. Only protein-protein interactions imex curation ctnd1_human Catenin delta-1 p120 catenin Cadherin-associated Src substrate p120(cas) CTNND1 KIAA0384 protein protein human Homo sapiens Human MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI src8_human Src substrate cortactin CTTN EMS1 Amplaxin Oncogene EMS1 protein protein human Homo sapiens Human MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ src8_mouse Src substrate cortactin Cttn Ems1 protein protein mouse Mus musculus Mouse MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ ctnd1_mouse Catenin delta-1 Kiaa0384 p120 catenin Cadherin-associated Src substrate p120(cas) Ctnnd1 Catns protein protein mouse Mus musculus Mouse MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANSLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHNHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETTDDGTTRRTETTVKKVVKTMTTRTVQPVPMGPDGLPVDASAVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYGRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPPDQYYWAPLAQHERGSLASLDSLRKGMPPPSNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPILVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEALPTVANSTGPHAASCFGAKKGKDEWFSRGKKPTEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIAELLTSEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVVSILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIPMSNMGSNTKSLDNNYSTLNERGDHNRTLDRSGDLGDMEPLKGAPLMQKI cttn-ctnnd1-1 3157806 N/A 3157812 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3157813 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false cttn-ctnnd1-2 3157807 N/A 3157814 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3157815 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false ctnnd1-cttn-1 3157808 N/A 3157814 unspecified role unspecified role prey prey Region 1-330 Region 1-330 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3157815 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ctnnd1-cttn-2 3157809 N/A 3157815 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3157813 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ctnnd1-cttn-3 3157810 N/A 3157814 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Reion 1-330 Reion 1-330 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3157815 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ctnnd1-cttn-4 3157811 N/A 3157814 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3157815 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false