DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yan-2007-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yan Q., Malashkevich VN., Fedorov A., Fedorov E., Cao E., Lary JW., Cole JL., Nathenson SG., Almo SC. DIP original experiment: DIP-261633X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of CD84 provides insight into SLAM family function. Yan Q., Malashkevich VN., Fedorov A., Fedorov E., Cao E., Lary JW., Cole JL., Nathenson SG., Almo SC. Only protein-protein interactions imex curation yan-2007-4 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Yan Q., Malashkevich VN., Fedorov A., Fedorov E., Cao E., Lary JW., Cole JL., Nathenson SG., Almo SC. DIP original experiment: DIP-261634X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of CD84 provides insight into SLAM family function. Yan Q., Malashkevich VN., Fedorov A., Fedorov E., Cao E., Lary JW., Cole JL., Nathenson SG., Almo SC. Only protein-protein interactions imex curation yan-2007-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yan Q., Malashkevich VN., Fedorov A., Fedorov E., Cao E., Lary JW., Cole JL., Nathenson SG., Almo SC. DIP original experiment: DIP-261635X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of CD84 provides insight into SLAM family function. Yan Q., Malashkevich VN., Fedorov A., Fedorov E., Cao E., Lary JW., Cole JL., Nathenson SG., Almo SC. Only protein-protein interactions imex curation slaf5_human SLAM family member 5 CD84 SLAMF5 Cell surface antigen MAX.3 Hly9-beta Leukocyte differentiation antigen CD84 Signaling lymphocytic activation molecule 5 protein protein human Homo sapiens Human MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI cd84-1 3157662 N/A 3157665 unspecified role unspecified role unspecified role unspecified role Region 22-131 Region 22-131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd84-2 3157663 N/A 3157665 unspecified role unspecified role unspecified role unspecified role Region 22-131 Region 22-131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd84-3 3157664 N/A 3157665 unspecified role unspecified role unspecified role unspecified role Region 22-131 Region 22-131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false