DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hombauer-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66863X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66869X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66870X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66866X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66865X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66867X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66868X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66861X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66864X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66872X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66871X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation hombauer-2007-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. DIP original experiment: DIP-66862X PLoS biology 2007 IMEx Generation of active protein phosphatase 2A is coupled to holoenzyme assembly. Hombauer H., Weismann D., Mudrak I., Stanzel C., Fellner T., Lackner DH., Ogris E. Only protein-protein interactions imex curation ptpa2_yeast Serine/threonine-protein phosphatase 2A activator 2 RRD2 Peptidyl-prolyl cis-trans isomerase PTPA-2 Phosphotyrosyl phosphatase activator 2 YPL152W NOH1 YPA2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLPEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFLPCPDGVSPPRGHIHDGTDKDDECNFEGHVHTTWGDCCGIKLPSAIAATEMNKKHHKPIPFD E0BE8A7EDD54E306 2aaa_yeast Protein phosphatase PP2A regulatory subunit A TPD3 YAL016W FUN32 PR65 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGARSTTAGAVPSAATTSTTSTTSNSKDSDSNESLYPLALLMDELKHDDIANRVEAMKKLDTIALALGPERTRNELIPFLTEVAQDDEDEVFAVLAEQLGKFVPYIGGPQYATILLPVLEILASAEETLVREKAVDSLNNVAQELSQEQLFSDFVPLIEHLATADWFSSKVSACGLFKSVIVRIKDDSLRKNILALYLQLAQDDTPMVKRAVGKNLPILIDLLTQNLGLSTDEDWDYISNIFQKIINDNQDSVKFLAVDCLISILKFFNAKGDESHTQDLLNSAVKLIGDEAWRVRYMAADRFSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVREAVAKQVSGFAKFLNDPSIILNKILPAVQNLSMDESETVRSALASKITNIVLLLNKDQVINNFLPILLNMLRDEFPDVRLNIIASLKVVNDVIGIELLSDSLLPAITELAKDVNWRVRMAIIEYIPILAEQLGMQFFDQQLSDLCLSWLWDTVYSIREAAVNNLKRLTEIFGSDWCRDEIISRLLKFDLQLLENFVSRFTILSALTTLVPVVSLDVVTEQLLPFISHLADDGVPNIRFNVAKSYAVIVKVLIKDEAKYDALIKNTILPSLQTLCQDEDVDVKYFAKKSLAECQELLKN 7ED350FB20633DC8 pp2a1_yeast Serine/threonine-protein phosphatase PP2A-1 catalytic subunit PPH21 D2180 YDL134C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSGIADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSVSRKTPDYFL D8D5757283C9BBD6 tap42_yeast Type 2A phosphatase-associated protein 42 YM9711.18 YM9973.01C YMR028W TAP42 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASVTEQFNDIISLYSTKLEHTSLRQDSPEYQGLLLSTIKKLLNLKTAIFDRLALFSTNETIDDVSTASIKFLAVDYYLGLLISRRQSNDSDVAQRQSMKLIYLKKSVESFINFLTLLQDYKLLDPLVGEKLGNFKDRYNPQLSELYAQPKNNKDLSGAQLKRKEKIELFQRNKEISTKLHCLELELKNNDEDHDHDELLRELYLMRLHHFSLDTINNIEQNLFECEMLSNFLKNSVHEVKSSGTQIRKESNDDDSTGFTDKLENINKPLIDKKGQVLRNFTLVDKRQQLQQKVRGYGQYGPTMSVEEFLDKEFEEGRVLQGGEEPEQAPDEENMDWQDRETYKAREWDEFKESHAKGSGNTMNRG 16F1E236BEC696DD ppme1_yeast Protein phosphatase methylesterase 1 PPE1 Yms2 YHR075C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDDLRRKIALSQFERAKNVLDATFQEAYEDDENDGDALGSLPSFNGQSNRNRKYTGKTGSTTDRISSKEKSSLPTWSDFFDNKELVSLPDRDLDVNTYYTLPTSLLSNTTSIPIFIFHHGAGSSGLSFANLAKELNTKLEGRCGCFAFDARGHAETKFKKADAPICFDRDSFIKDFVSLLNYWFKSKISQEPLQKVSVILIGHSLGGSICTFAYPKLSTELQKKILGITMLDIVEEAAIMALNKVEHFLQNTPNVFESINDAVDWHVQHALSRLRSSAEIAIPALFAPLKSGKVVRITNLKTFSPFWDTWFTDLSHSFVGLPVSKLLILAGNENLDKELIVGQMQGKYQLVVFQDSGHFIQEDSPIKTAITLIDFWKRNDSRNVVIKTNWGQHKTVQNT AD00BEA4FB7795EE 2aba_yeast Protein phosphatase PP2A regulatory subunit B CDC55 YGL190C G1345 PR55 Cell division control protein 55 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAQNNFDFKFSQCFGDKADIVVTEADLITAVEFDYTGNYLATGDKGGRVVLFERSNSRHCEYKFLTEFQSHDAEFDYLKSLEIEEKINEIKWLRPTQRSHFLLSTNDKTIKLWKVYEKNIKLVSQNNLTEGVTFAKKGKPDNHNSRGGSVRAVLSLQSLKLPQLSQHDKIIAATPKRIYSNAHTYHINSISLNSDQETFLSADDLRINLWNLDIPDQSFNIVDIKPTNMEELTEVITSAEFHPQECNLFMYSSSKGTIKLCDMRQNSLCDNKTKTFEEYLDPINHNFFTEITSSISDIKFSPNGRYIASRDYLTVKIWDVNMDNKPLKTINIHEQLKERLSDTYENDAIFDKFEVNFSGDSSSVMTGSYNNNFMIYPNVVTSGDNDNGIVKTFDEHNAPNSNSNKNIHNSIQNKDSSSSGNSHKRRSNGRNTGMVGSSNSSRSSIAGGEGANSEDSGTEMNEIVLQADKTAFRNKRYGSLAQRSARNKDWGDDIDFKKNILHFSWHPRENSIAVAATNNLFIFSAL 6DA12C2805FA6A82 pph21-rrd2-1 3157295 N/A 3157307 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157307 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157310 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-cdc55-10 3157296 N/A 3157311 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157312 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-cdc55-11 3157297 N/A 3157312 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-ppe1-1 3157298 N/A 3157311 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pph21-pph21-1 3157299 N/A 3157307 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-ppe1-2 3157300 N/A 3157311 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157311 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-cdc55-12 3157301 N/A 3157312 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157307 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-rrd2-2 3157302 N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157307 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157310 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false rrd2-pph21-1 3157303 N/A 3157309 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157307 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157308 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-rrd2-3 3157304 N/A 3157307 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pph21-ppe1-3 3157305 N/A 3157307 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157311 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pph21-tap42-2 3157306 N/A 3157309 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157310 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false