DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stoler-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Stoler S., Rogers K., Weitze S., Morey L., Fitzgerald-Hayes M., Baker RE. DIP original experiment: DIP-261606X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Scm3, an essential Saccharomyces cerevisiae centromere protein required for G2/M progression and Cse4 localization. Stoler S., Rogers K., Weitze S., Morey L., Fitzgerald-Hayes M., Baker RE. Only protein-protein interactions imex curation stoler-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Stoler S., Rogers K., Weitze S., Morey L., Fitzgerald-Hayes M., Baker RE. DIP original experiment: DIP-261607X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Scm3, an essential Saccharomyces cerevisiae centromere protein required for G2/M progression and Cse4 localization. Stoler S., Rogers K., Weitze S., Morey L., Fitzgerald-Hayes M., Baker RE. Only protein-protein interactions imex curation stoler-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Stoler S., Rogers K., Weitze S., Morey L., Fitzgerald-Hayes M., Baker RE. DIP original experiment: DIP-261608X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Scm3, an essential Saccharomyces cerevisiae centromere protein required for G2/M progression and Cse4 localization. Stoler S., Rogers K., Weitze S., Morey L., Fitzgerald-Hayes M., Baker RE. Only protein-protein interactions imex curation scm3_yeast Protein SCM3 Suppressor of chromosome missegregation protein 3 SCM3 YDL139C D2155 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKTNKKISKRRSLKNLHGALKGLLKESGKKSESKIRKHSDCNPVHRVYPPNIEKRKTKKDDGISRPIAERNGHVYIMSKENHIIPKLTDDEVMERHKLADENMRKVWSNIISKYESIEEQGDLVDLKTGEIVEDNGHIKTLTANNSTKDKRTKYTSVLRDIIDISDEEDGDKNDEYTLWANDSEASDSEVDADNDTEEEKDEKLIDADFKKYEAKLSKRILRD D7668117BCC7FF12 cenpa_yeast Histone H3-like centromeric protein CSE4 CSE4 Chromosome segregation protein 4 CENP-A homolog CSL2 YKL262 YKL049C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKQQWVSSAIQSDSSGRSLSNVNRLAGDQQSINDRALSLLQRTRATKNLFPRREERRRYESSKSDLDIETDYEDQAGNLEIETENEEEAEMETEVPAPVRTHSYALDRYVRQKRREKQRKQSLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI 0170A10060EEC309 scm3-scm3-1 3157193 N/A 3157196 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157196 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false scm3-cse4-1 3157194 N/A 3157197 unspecified role unspecified role prey prey Region 132-229 Region 132-229 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157196 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cse4-scm3-1 3157195 N/A 3157196 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3157197 unspecified role unspecified role bait bait ProA-tag ProA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false