DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2007-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. DIP original experiment: DIP-261572X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival. Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. Only protein-protein interactions imex curation liu-2007-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. DIP original experiment: DIP-261574X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival. Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. Only protein-protein interactions imex curation liu-2007-7 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. DIP original experiment: DIP-261576X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival. Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. Only protein-protein interactions imex curation liu-2007-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. DIP original experiment: DIP-261573X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival. Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. Only protein-protein interactions imex curation liu-2007-9 human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. DIP original experiment: DIP-261575X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival. Liu X., Liu Z., Jang SW., Ma Z., Shinmura K., Kang S., Dong S., Chen J., Fukasawa K., Ye K. Only protein-protein interactions imex curation p06748-1 Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Nucleolar protein NO38 Numatrin protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK sumo1-npm1-1 3157110 N/A 3157115 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P06748-1:p.Lys263Arg K263R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06748-1:p.Lys230Arg K230R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3157116 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false npm1-sumo1-1 3157111 N/A 3157115 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3157116 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sumo3-npm1-1 3157112 N/A 3157117 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3157115 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false rb1-npm1-1 3157113 N/A 3157115 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P06748-1:p.Lys263Arg K263R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3157118 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false sumo1-npm1-2 3157114 N/A 3157115 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3157116 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false