DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ji-2007-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261485X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions imex curation ji-2007-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261488X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions imex curation ji-2007-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261486X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions imex curation ji-2007-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261489X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions imex curation ji-2007-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261487X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions imex curation ji-2007-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261490X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions imex curation nos3_human Nitric oxide synthase, endothelial Endothelial NOS EC-NOS NOS type III Constitutive NOS NOS3 protein protein human Homo sapiens Human MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDTNSP actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI nos3_bovin Nitric oxide synthase, endothelial NOS3 Endothelial NOS EC-NOS NOS type III Constitutive NOS protein protein bovin Bos taurus (Bovine) Bovine MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPATPHAPDHSPAPNSPTLTRPPEGPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRCCLGSLVLPRKLQTRPSPGPPPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRYQPDPWKGSATKGAGITRKKTFKEVANAVKISASLMGTLMAKRVKATILYASETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAKAAFQASCETFCVGEEAKAAAQDIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRATILVRLDTAGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTESVAVEQLEKGSPGGPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPNAHPGEVHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPYVPCILVGPGTGIAPFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQERGVFGRVLTAFSREPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGPDTPGP mint Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. No mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets nos3-actb-1 3156395 N/A 3156401 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3156402 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false nos3-cav1-1 3156396 N/A 3156401 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3156403 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false actb-nos3-1 3156397 N/A 3156404 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3156402 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction false false false actb-cav1-1 3156398 N/A 3156403 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3156402 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false actb-nos3-2 3156399 N/A 3156401 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3156402 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false nos3-actb-2 3156400 N/A 3156401 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3156402 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false