DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ petalcorin-2007-1 in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. DIP original experiment: DIP-261407X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Stabilization of RAD-51-DNA filaments via an interaction domain in Caenorhabditis elegans BRCA2. Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. Only protein-protein interactions imex curation petalcorin-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. DIP original experiment: DIP-261408X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Stabilization of RAD-51-DNA filaments via an interaction domain in Caenorhabditis elegans BRCA2. Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. Only protein-protein interactions imex curation petalcorin-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. DIP original experiment: DIP-261410X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Stabilization of RAD-51-DNA filaments via an interaction domain in Caenorhabditis elegans BRCA2. Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. Only protein-protein interactions imex curation petalcorin-2007-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. DIP original experiment: DIP-261411X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Stabilization of RAD-51-DNA filaments via an interaction domain in Caenorhabditis elegans BRCA2. Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. Only protein-protein interactions imex curation petalcorin-2007-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. DIP original experiment: DIP-261409X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Stabilization of RAD-51-DNA filaments via an interaction domain in Caenorhabditis elegans BRCA2. Petalcorin MI., Galkin VE., Yu X., Egelman EH., Boulton SJ. Only protein-protein interactions imex curation g5egg8_caeel DNA repair protein RAD51 homolog rad-51 CELE_Y43C5A.6 rad51 Y43C5A.6 protein protein caeel Caenorhabditis elegans MSAQASRQKKSDQEQRAADQALLNAAIEDNAMEQDENFTVIDKLESSGISSGDISKLKEAGYYTYESLAFTTRRELRNVKGISDQKAEKIMKEAMKFVQMGFTTGAEVHVKRSQLVQIRTGSASLDRLLGGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDTNATFRPERIIAIAQRYNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQMKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGGASMFQADAKKPIGGHIIAHMSTTRLYLRKGKGENRVAKMVQSPNLPEAEATYSITNHGIEDARED brc2_caeel DNA repair protein brc-2 T07E3.5 brc-2 protein protein caeel Caenorhabditis elegans MGDSSKKVKDSFDTISEPDSFDEPKGVPISMEPVFSTAAGIRIDVKQESIDKSKKMLNSDLKSKSSSKGGFSSPLVRKNNGSSAFVSPFRREGTSSTTTKRPASGGFEDFEAPPAKKSTSSSSKKSKKHSKKEKKKEFKEIHADVLRVSRIYEKDKFRIILQESSSTPLILATCSYNRGSDIKFGDRIHVDAEVCKKSSSGDVTEIYIDRVLKNKENGAKSGIRRHSIAKKPFCIKPRFIHELSDTKIKKTVVQVNLLDLNLDFYAGCSKCKHSLPEAANQCEFCKDSQGKSELSMYSRVRVMDFSGQMFINVTTKNMKKLLDLLGYEGFDNWFRFKDPQERQNYVFRPVMVEIEKSNDEWECTDVAEVDWKDFGSYLKHKEDKKKRRSKKKHP rad_51-1 3156012 N/A 3156017 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false brc_2-rad_51-2 3156013 N/A 3156018 unspecified role unspecified role bait bait Region 1-60 Region 1-60 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3156017 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad_51-rad_51-2 3156014 N/A 3156017 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3156017 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false brc_2-rad_51-3 3156015 N/A 3156018 unspecified role unspecified role bait bait Region 50-114 Region 50-114 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3156017 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false brc_2-rad_51-4 3156016 N/A 3156018 unspecified role unspecified role bait bait Region 1-60 Region 1-60 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3156017 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false