DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hasan-2007-1 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hasan UA., Caux C., Perrot I., Doffin AC., Menetrier-Caux C., Trinchieri G., Tommasino M., Vlach J. DIP original experiment: DIP-261422X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Cell proliferation and survival induced by Toll-like receptors is antagonized by type I IFNs. Hasan UA., Caux C., Perrot I., Doffin AC., Menetrier-Caux C., Trinchieri G., Tommasino M., Vlach J. Only protein-protein interactions imex curation o08769_rat Cyclin-dependent kinase inhibitor 1B Cdkn1b p27Kip1 rCG_29991 Cyclin-dependent kinase inhibitor p27 protein protein rat Rattus norvegicus (Rat) Rat MSNVRVSNGSPSLERMDARQTEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVPAQESLDVSGSRQAVPSIGSQANSEDRHLVDQMPDSSDSPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT mint cdk2_rat Cyclin-dependent kinase 2 Cdk2 Cell division protein kinase 2 Cdkn2 protein protein rat Rattus norvegicus (Rat) Rat MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGLPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL cdk2-cdkn1b-4 3155672 N/A 3155673 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3155674 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false