DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nicolas-2007-1 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66690X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-2 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66691X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-3 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66692X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-4 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66693X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-5 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66694X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-6 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66695X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-7 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66696X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-8 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66697X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-9 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66698X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-10 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66699X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-11 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66700X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-12 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66701X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation nicolas-2007-13 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. DIP original experiment: DIP-66702X Nature structural & molecular biology 2007 IMEx Distinct roles of HDAC complexes in promoter silencing, antisense suppression and DNA damage protection. Nicolas E., Yamada T., Cam HP., Fitzgerald PC., Kobayashi R., Grewal SI. Only protein-protein interactions imex curation yac5_schpo Uncharacterized protein C16C9.05 SPAC16C9.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASSINNSSQPTVPSISNNSHGDSFVNEGPPSNFKNNSLTSSTHSSTDHVNVLPISQDKEMDISSPVKKQKASYSNKSPNKAPIQKSRGSSLKSHLETESQQTPVKRRRRKATIRNVDYCSACGGRGLFICCEGCPCSFHLSCLEPPLTPENIPEGSWFCVTCSIKSHHPPKHPLSIWSQLYDWIDSQNPSQYRLPDDLVHYFHGISRGDTGAYKETEGEMDTDEFSALPTGSSITNLAYCGYCSKPSMGACWVYGCQLCDTFYHKNCKEHAKKCSHDSIGKKGMRVPKNAVVIRTPLVLDTTSNTLNPKVMISGWQFLMGEFPSDELLYFPRLPVSCLYKVSEDGLIKDFLYAIGIEAKKFNNERKKRELEVIPPDVKSALLPARTHPNLPIALRTLFNKART CB9412F792C1C5D4 sds3_schpo Transcriptional regulatory protein sds3 sds3 Clr6 histone deacetylase complex I subunit Sds3 SPAC25B8.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDVLSRVFDNEKEELDPLLNNPLTASEFRAKKAELEAELESIRNGTCKTLLDLADELRRSRDEELEIAERWRTFLVNRAQEEYEVEMKAAKEEYEYRCKTLKEMVLSHLNEKKRKIYEAKDMFDIGSESSTLLLHDASSQFIDRRKLRHRRNAGNQQNTQQLPSLNFFDDYLLFPTDETAVIPQSVKNAVRNSVNSVKPTSAEASLFSPLLSMANANPTNGRERDPRASERAERDREKAVEKGLSGATEEDIQSDLQLLKKELAKKK AA0DE92BDCE75671 ing2_schpo Chromatin modification-related protein png2 png2 ING1 homolog 2 SPBC1709.11c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGTSGIEIFAALNDFTDAIVSVPESVCGKFTSLKEIDAQVRDIRQNVIQEIGVVLKNEKNDELSGEERCERLQKTLKEILPYSDSKICLATDAMNNIKSCIDRLDAGFEYVELEIPQQLRLGYPDDRALMNYHSTVTPQTSERRRETRRHQNNQHSQQYSSQERSSSYNNFEDASSPQSSYHTPTKRRKNAVPRKSSSPPLSSTKHAPQSTERRPVRRSESRLKQTNGEPLVKHDTLDSSDISREGEQLYCYCQQVSYGQMIGCDNENCKREWFHLPCVGLVEPPKGIWYCKECEELAKSSESRQ 3E509927B8C82885 eaf3_schpo Chromatin modification-related protein eaf3 alp13 eaf3 SPAC23H4.12 Altered polarity protein 13 ESA1-associated factor 3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAVSYKVNERVLCFHGPLLYEAKIVDTEMKGDVTTYLIHYKGWKNSWDEWVEQDRILQWTEENLKTQKELKNAAISTRQKPTSKKSASSTSKHDSTGVKTSGKRSRESSTVTVDGDSHELPSRIKTQKSESPIPQQVKRDGTTDAKNEETTKPENNEKDDFEEEPPLPKHKISVPDVLKLWLVDDWENITKNQQLIAIPRNPTVRAAIAAFRESKISHLNNEIDVDVFEQAMAGLVIYFNKCLGNMLLYRFERQQYLEIRQQYPDTEMCDLYGVEHLIRLFVSLPELIDRTNMDSQSIECLLNYIEEFLKYLVLHKDEYFIKEYQNAPPNYRSLVGV 827B85CE12CAE8CC prw1_schpo RbAp48-related WD40 repeat-containing protein prw1 prw1 SPAC29A4.18 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAVSAVPHPSKQAQASEEGINQEKCINEEYKIWKKNSPFLYDLIITRALEWPCMSLQWYPEQQIFAEHGYTEQKMFLGVRADVGKYLLAVASIQLPYLNQTVPPTTMEGASAGDESSLRVNISNLYSHPESVCSAKLMPQDDSCVATVGNYHNDVLVFDKESFESYSSASESPLKPKYRLTKHTQPCTSVCWNFLSKGTLVSGSQDATLSCWDLNAYNESDSASVLKVHISSHEKQVSDVRFHYKHQDLLASVSYDQYLHVHDIRRPDASTKPARSVHAHSGPIHSVAFNPHNDFILATCSTDKTIALWDLRNLNQRLHTLEGHEDIVTKISFSPHEEPILASTSADRRTLVWDLSRIGEDQPAEEAQDGPPELLFMHGGHTSCTIDMDWCPNYNWTMATAAEDNILQIWTPSRSIWGNEQLEEDATAYLS 4AFF1BDA12C4DBC2 pst2_schpo Paired amphipathic helix protein pst2 pst2 SPAC23C11.15 SIN3 homolog 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEQTLAILKNDNSTLVAEMQNQLVHDFSPNGTALPELDIKAFVQKLGQRLCHRPYVYSAFMDVVKALHNEIVDFPGFIERISVILRDYPDLLEYLNIFLPSSYKYLLSNSGANFTLQFTTPSGPVSTPSTYVATYNDLPCTYHRAIGFVSRVRRALLSNPEQFFKLQDSLRKFKNSECSLSELQTIVTSLLAEHPSLAHEFHNFLPSSIFFGSKPPLGSFPLRGIQSSQFTLSNISDLLSQSRPDNLSPFSHLSNESSDFFKNVKNVLTDVETYHEFLKLLNLYVQGIIDRNILVSRGFGFLKSNSGLWRSFLSLTSLSPEEFLSVYNSACSDFPECGPSYRLLPVEERNISCSGRDDFAWGILNDDWVSHPTWASEESGFIVQRKTPYEEAMTKLEEERYEFDRHIEATSWTIKSLKKIQNRINELPEEERETYTLEEGLGLPSKSIYKKTIKLVYTSEHAEEMFKALERMPCLTLPLVISRLEEKNEEWKSVKRSLQPGWRSIEFKNYDKSLDSQCVYFKARDKKNVSSKFLLAEADILRSQAKLHFPLRSRSAFEFSFVYDNEIVLFDTCYMVCTYIVCNSPSGLKKVEHFFKNILPLHFGLEKDKFSIFLDQVFRGPDYDVNAPNIVGNKPVRRKRSNSITQLTEFVKQPKINGQRESRSAAAARKKEESGNKSQSNSQNSLSDESGNVTPVSKKQLSQPAAAIKASLKYPSHPDSLLEHQDHAGDTENEMHDDVDKEQFGYSSMYVFFRLFNLLYERLYELQRLEDQVSIIQQRIIPNPVSQKQKIWRDRWNDLSDVPDEKTHYENTYVMILRLIYGIVDQSAFEDYLRFYYGNKAYKIYTIDKLVWSAAKQVHHIVSDGKYKFVTSLVEQNSSASPKKNYDDFLYRLEIEKLLNPDEILFRFCWINKFKSFGIKIMKRANLIVDQSLDTQRRVWKKYVQNYRIQKLTEEISYKNYRCPFLCRNIEKERTVEQLVSRLQTKLLRSAELVSGLQAKLCLDSFKLLYLPRTEDSYIDASYLRLRDTDFLDCQNKRKQRWRNRWESLLKSVRGTSDNTAEVNFDADINALFIP 1AD301DB4EB1AFFB pst1_schpo Paired amphipathic helix protein pst1 pst1 SPBC12C2.10c SPBC21D10.01c SIN3 homolog 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAKDWQDARLGQCHRLEDYSNVAINYTGPYLTPSGTMAYHPGNAPLFTQAPPHTNPQGPPPFPLFNSISPVYDPATGRLLYRNVNTQVSHTAIPNPANGYAAVYGGPPSQLPPPPQPQSHPNVTVISASPARAIEQQPTILSSTDSNIPRPGTVKSSASPFVPNQNPSAPPPPPQEYRQLNVTDALSYLDLVKLQFHQEPEIYNEFLDIMKEFKSQAIETPEVITRVSKLFAGYPNLIQGFNTFLPPGYSIEISSADPGSLAGIHITTPQGPLMINDLGKTTAPPPPHGSTTPLPAAASYTSMNMKQSSASHPVLQPPAPSTLQFNPSPSPAAPSYPPVDASVKQAADLDQAINFVNNVKNRFSHKPEAYNSFLDILKSYQHDQRPIQLVYFQVSQLFAEAPDLLEEFKRFLPDVSVNAPAETQDKSTVVPQESATATPKRSPSATPTSALPPIGKFAPPTTAKAQPAPEKRRGEPAVQTRNHSKRTRTATSSVEETTPRAFNVPIAQNKNPSELEFLEHARQYLANESKYNEFIKLLELYSQEVFDKNALVERCYVFFGSNEHLMNWLKDLVKYNPANPIPVPRPRVDLTQCKSCGPSYRLLPKIELLLPCSGRDDLCWTILNDAWVSFPTLASEDSGFIAHRKNQFEENLHKLEEERYEYDRHIGANMRFIELLQIHADKMLKMSEVEKANWTLPSNLGGKSVSIYHKVIKKVYGKEHAQQIIENLQKNPSVTIPIVLERLKKKDREWRSLQNHWNELWHDIEEKNFYRSLDHQGVSFKSVDKKSTTPKFLISELRNLAQQQKVELSEGKVTPSHQFLFSYKDPNIITDIARLFGVFLIHGSTHSAEDNEKMSNFLRSFLSLFFDVPYDSFIPYLPTHFNEEESDIDSLSSSLIEKPRASSSPIHHANNNGLRLLKDVLKKTYRGARENRSSVKEDYVSESTERTPDASEIDEHISEHEENDDESSSVFSTGEVWVNCKFTDTDGSLLDDGTKLSDRSVYNLFGNMSLYCFFRLFHTLYSRLEEIKNLEQMAYSKQHDVKSNPVAVELGLVRHPSERLGFALPTADTVYEQAIQLCERLMEGEIDQNGFEDALRCLYGIHAFRLYTVEKLVTSIIKQLHSVTTNRRLAQVFMYYEKDRVQRRTSPRQQIMYRIQTETAFGPDENLCCIDWNSQTRQSAIRLMGREDLTMGTLKSDAEKWCYYIGSYIMSSPTEGILPEHVRIPFLRKCLPSDEGNEDDESSSVVKSANAIITSFLESGLALTIPINTVKIRYENGTEDVFARNSEQVYNGPYDKIRDYRQSKWREWLNSDEGWTQGLSKDKVRRIKPCTIESLFNESTLRSGKAERFSENAGVESIGKKGKNLLNESGNGKKLDKGLPPKVNGKSSVTRGNKTNLKARNGRNNDDSSNKINLSEKEKEKESIEDEEKNREGSMSPVAKHASDVEDDHDVAKSTAPDFETSSHRPERSSEKKSPSPVFTSVKQTAENDADNEDDKTDMDDQTEETLDADNTMEEEPSKDDL 38433F99E153DDD2 clr6_schpo Histone deacetylase clr6 clr6 SPBC36.05c Cryptic loci regulator 6 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGFGKKKVSYFYDEDVGNYHYGPQHPMKPHRVRMVHNLVVNYNLYEKLNVITPVRATRNDMTRCHTDEYIEFLWRVTPDTMEKFQPHQLKFNVGDDCPVFDGLYEFCSISAGGSIGAAQELNSGNAEIAINWAGGLHHAKKREASGFCYVNDIALAALELLKYHQRVLYIDIDVHHGDGVEEFFYTTDRVMTCSFHKFGEYFPGTGHIKDTGIGTGKNYAVNVPLRDGIDDESYESVFKPVISHIMQWFRPEAVILQCGTDSLAGDRLGCFNLSMKGHSMCVDFVKSFNLPMICVGGGGYTVRNVARVWTYETGLLAGEELDENLPYNDYLQYYGPDYKLNVLSNNMENHNTRQYLDSITSEIIENLRNLSFAPSVQMHKTPGDFTFENAEKQNIAKEEIMDERV 8EDEA43D5839E367 ya27_schpo Uncharacterized protein C2F7.07c SPAC2F7.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDAKPWNHTSEAFQASILEDLKIIQKAGAERNAKSSHGSINSRSASPNKATSRRNRAQNGNSNGRASVDNSDDGSKDDLDYSPSVKRKHVNGEGAEKGDHDTSNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPGNFLCCETCPNSFHFTCIDPPIEEKNLPDDAWYCNECKHHSLYNELDEQEELESNVKEEGTMVDVWMQLCTYIDSHNPIQFHLPHSISSFFRGVGSGVMGEYIETDVLKHLKSSRRSNGEERDPLLLKSKSGTPILCFRCHKSALVSQSILACDYCNSYWHPDCLNPPLATLPSNLRKWKCPNHSDHVTPRYRLPEKAKVIRVGLPRGFKNKGNIVIDENEDEPSVQTIQLQGKIRVVPSKPFKLNFLEQIRDNVINLRKMVEQDEQLCIETFSKFDFYATRDCELPLRILCDVANDNLENDDYVLALRDLLRISKWDPNQPVPAPFDLANLLSY 433CE6520BA4714C clr6-alp13-1 3155333 N/A 3155346 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155347 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155348 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155349 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155351 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155352 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false clr6-png2-1 3155334 N/A 3155347 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155348 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false cph1-clr6-1 3155335 N/A 3155346 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false alp13-clr6-1 3155336 N/A 3155354 unspecified role unspecified role prey prey N/A 3155346 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155349 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155351 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false clr6-prw1-1 3155337 N/A 3155347 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155352 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false clr6-png2-2 3155338 N/A 3155348 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155347 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155352 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false alp13-clr6-2 3155339 N/A 3155349 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155351 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role neutral component neutral component schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false pst1-clr6-1 3155340 N/A 3155347 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155348 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155352 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false alp13-clr6-3 3155341 N/A 3155349 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155351 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false sds3-clr6-1 3155342 N/A 3155351 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155347 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155348 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false prw1-png2-1 3155343 N/A 3155347 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155348 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false cph1-alp13-1 3155344 N/A 3155346 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155349 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155351 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false cph2-alp13-1 3155345 N/A 3155351 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155353 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155354 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155349 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3155350 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false