DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cansizoglu-2007-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66685X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation cansizoglu-2007-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66688X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation cansizoglu-2007-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66686X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation cansizoglu-2007-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66687X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation cansizoglu-2007-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66683X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation cansizoglu-2007-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66689X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation cansizoglu-2007-7 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. DIP original experiment: DIP-66684X Nature structural & molecular biology 2007 IMEx Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu AE., Lee BJ., Zhang ZC., Fontoura BM., Chook YM. Only protein-protein interactions imex curation m9m M9M peptide GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR protein protein in vitro In vitro GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR tnpo1_human Transportin-1 TRN TNPO1 KPNB2 MIP1 Importin beta-2 Karyopherin beta-2 M9 region interaction protein protein protein human Homo sapiens Human MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV p09651-2 Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF Is twenty times more abundant than isoform A1-B. hnrpm_human Heterogeneous nuclear ribonucleoprotein M HNRNPM HNRPM NAGR1 protein protein human Homo sapiens Human MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIPPSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIGSGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRNA m9m-tnpo1-1 3155102 N/A 3155109 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3155110 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false m9m-tnpo1-2 3155103 N/A 3155109 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false ecolx Escherichia coli N/A 3155110 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false hnrnpa1-tnpo1-1 3155104 N/A 3155111 unspecified role unspecified role neutral component neutral component 263-295 binding region 263-295 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P09651-2:p.Gly274Ala G274A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3155110 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false hnrnpm-tnpo1-1 3155105 N/A 3155112 unspecified role unspecified role bait bait 41-70 binding region 41-70 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3155110 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false hnrnpm-tnpo1-2 3155106 N/A 3155112 unspecified role unspecified role neutral component neutral component 41-70 binding region 41-70 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3155110 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false hnrnpa1-tnpo1-2 3155107 N/A 3155111 unspecified role unspecified role bait bait 263-295 binding region 263-295 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P09651-2:p.Gly274Ala G274A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3155110 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false hnrnpm-tnpo1-3 3155108 N/A 3155112 unspecified role unspecified role neutral component neutral component 41-70 binding region 41-70 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P52272:p.Pro63_Tyr64delinsAlaAla P63A,Y64A mutation mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3155110 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false