DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pizzato-2007-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261342X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261350X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261348X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261344X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261346X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-6 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261351X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261345X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261343X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261349X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation pizzato-2007-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. DIP original experiment: DIP-261347X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef. Pizzato M., Helander A., Popova E., Calistri A., Zamborlini A., Palù G., Göttlinger HG. Only protein-protein interactions imex curation nef_hv1la Protein Nef nef Negative factor 3'ORF protein protein hv1la Human immunodeficiency virus type 1 group M subtype B (isolate Lai) MGGKWSKSSVVGWPAVRERMRRAEPAADGVGAVSRDLEKHGAITSSNTAATNADCAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPEPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTRLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEY fragmentation type: fragment Bypasses host T-cell signaling by inducing a transcriptional program nearly identical to that of anti-CD3 cell activation. Interacts with the TCR-zeta chain to up-regulate the Fas ligand (FasL). Increasing surface FasL molecules and decreasing surface MHC-I molecules send attacking cytotoxic T-cell into apoptosis Protects the infected cell from apoptosis in order to keep it alive until the next virus generation is ready to strike. Inhibits the Fas and TNFR-mediated death signals by blocking MAP3K5. Interacts with p53 and decreases the half-life of the latter, protecting the infected cell against p53-mediated apoptosis. Inhibits the apoptotic signals regulated by the Bcl-2 family proteins through the formation of a Nef/PI3-kinase/PAK2 complex that induces phosphorylation of Bad mint Early protein that seems to play a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Enhances virus infectivity and pathogenicity Down-modulates surface MHC-I molecules. Internalized molecules are sequestred to the trans-Golgi network (TGN). Also decreases cell surface CD4 antigen by interacting with the Src family kinase LCK thereby inducing LCK-CD4 dissociation and by increasing clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Peroxisomal acyl-coenzyme A thioester hydrolase 1 (PTE1) seems to be involved in this process. May serve as a direct bridge between CD4 and the cellular endocytic machinery by interacting with beta-COP and adaptins. In consequence, surface MHC-I and CD4 are decreased and infected cells are masked for immune recognition by cytotoxic T lymphocytes. Decreasing the number of viral receptors prevents reinfection by more HIV particles dyn2_human Dynamin-2 DNM2 DYN2 protein protein human Homo sapiens Human MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD q88019_siv nef protein protein siv Simian immunodeficiency virus MGGAISMRRSRPSGDLRQRLLRARGETYGRLLGEVEDGYSQSPGGLDKGLSSLSCEGQKYNQGQYMNTPWRNPAEEREKLAYRKQNMDDIDE nef_hv193 Protein Nef nef 3'ORF Negative factor protein protein hv193 Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) HIV-1 MGGKWSKSSIVGWPAIRERMRRTPPTPPAAEGVGAVSQDLERRGAITSSNTRANNPDLAWLEAQEEDEVGFPVRPQVPLRPMTYKGAVDLSHFLKEKGGLEGLIYSKRRQEILDLWVYHTQGYFPDWQNYTPGPGIRYPLTMGWCFKLVPVDPEEVEKANEGENNCLLHPMSQHGMEDEDKEVLKWEFDSRLALRHIARERHPEYYQD q994m8_9hiv1 Protein Nef nef 3'ORF Negative factor protein protein 9hiv1 Human immunodeficiency virus 1 MGGKWSKSSLVGWPNVRERMRRTEPAAEGVGAASRDLDKHGALTSSNTAHNNADCAWLQAQEETEEVGFPVRPQVPLRPMTYKAAIDLSFFLKEKGGLEGLIHSKRRQDILDLWVYHTQGYFPDWQNYTPGPGVRYPLTFGWCFKLVPVDPSEVEEANKGENNCLLHPMSQHGIEDAEREVLKWEFDSSLARRHIAREKHPEYYKDC nef_hv1a2 Protein Nef nef Negative factor 3'ORF protein protein hv1a2 Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) MGGKWSKRSMGGWSAIRERMRRAEPRAEPAADGVGAVSRDLEKHGAITSSNTAATNADCAWLEAQEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGLEGLIWSQRRQEILDLWIYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEKVEEANEGENNSLLHPMSLHGMEDAEKEVLVWRFDSKLAFHHMARELHPEYYKDC Down-modulates surface MHC-I molecules. Internalized molecules are sequestred to the trans-Golgi network (TGN). Also decreases cell surface CD4 antigen by interacting with the Src family kinase LCK thereby inducing LCK-CD4 dissociation and by increasing clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Peroxisomal acyl-coenzyme A thioester hydrolase 1 (PTE1) seems to be involved in this process. May serve as a direct bridge between CD4 and the cellular endocytic machinery by interacting with beta-COP and adaptins. In consequence, surface MHC-I and CD4 are decreased and infected cells are masked for immune recognition by cytotoxic T lymphocytes. Decreasing the number of viral receptors prevents reinfection by more HIV particles Bypasses host T-cell signaling by inducing a transcriptional program nearly identical to that of anti-CD3 cell activation. Interacts with the TCR-zeta chain to up-regulate the Fas ligand (FasL). Increasing surface FasL molecules and decreasing surface MHC-I molecules send attacking cytotoxic T-cell into apoptosis Protects the infected cell from apoptosis in order to keep it alive until the next virus generation is ready to strike. Inhibits the Fas and TNFR-mediated death signals by blocking MAP3K5. Interacts with p53 and decreases the half-life of the latter, protecting the infected cell against p53-mediated apoptosis. Inhibits the apoptotic signals regulated by the Bcl-2 family proteins through the formation of a Nef/PI3-kinase/PAK2 complex that induces phosphorylation of Bad mint homomint Early protein that seems to play a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Enhances virus infectivity and pathogenicity nef_hv190 Protein Nef nef 3'ORF Negative factor protein protein hv190 Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) HIV-1 MGGKWSKSRMGGWSTIRERMRRAEPVAEGVGAVSRDLDRRGAVTINNTASTNRDAAWLEAQEDGEEVGFPVRPQVPLRPMTYKGAFDLSHFLKEKGGLDGLIYSKQRQDILDLWVYNTQGYFPDWQNYTPGPGERFPLTFGWCFKLVPVNPQEVEQANEGENNSLLHPMSLHGMEDDGREVLMWKFDSRLALTHLARVKHPEYKDC o41790_9hiv1 Protein Nef nef 3'ORF Negative factor protein protein 9hiv1 Human immunodeficiency virus 1 MGGKWSKSSIVGWPAVRERMRRTEPAAEGVGAASRDLEKHGAITSSNTAQTNDACAWLEAQEEEEVGFPVRPQVPLRPMTYKEAVDLSHFLKEKGGLEGLVWSPKRQEILDLWVYHTQGFFPDWQNYTPGPGIRYPLTFGWCFELVPMEPKEVEENTEGEDNCLLHPINQHGMEDPEREVLVWRFNSRLAFEHKAKMKHPEYYKDC nef-dnm2-1 3154903 N/A 3154913 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9QPN3:p.[Gly2Ala;Gly3Ala] G2A/G3A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9QPN3:p.[Phe121Ala;Asp123Ala] F121A/D123A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9QPN3:p.Leu112Ala L112A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9QPN3:p.Phe121Ala F121A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9QPN3:p.Asp123Ala D123A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false nef-dnm2-2 3154904 N/A 3154915 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false nef-dnm2-3 3154905 N/A 3154916 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false nef-dnm2-4 3154906 N/A 3154913 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false nef-dnm2-5 3154907 N/A 3154917 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false nef-dnm2-6 3154908 N/A 3154913 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9QPN3:p.[Gly2Ala;Gly3Ala] G2A/G3A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false nef-dnm2-7 3154909 N/A 3154918 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false nef-dnm2-8 3154910 N/A 3154913 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-727 Region 1-727 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false nef-dnm2-9 3154911 N/A 3154919 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false nef-dnm2-10 3154912 N/A 3154920 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3154914 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false