DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ miggin-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261116X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions imex curation miggin-2007-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261118X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions imex curation miggin-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261121X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions imex curation miggin-2007-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261119X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions imex curation miggin-2007-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261117X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions imex curation miggin-2007-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261120X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions imex curation casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH p58753-2 Toll/interleukin-1 receptor domain-containing adapter protein TIRAP MAL Adaptor protein Wyatt MyD88 adapter-like protein protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS tirap-casp1-1 3154101 N/A 3154107 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3154108 unspecified role unspecified role bait bait Region 72-235 Region 72-235 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false casp1-tirap-1 3154102 N/A 3154109 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3154107 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false tirap-casp1-2 3154103 N/A 3154107 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3154108 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false casp1-tirap-2 3154104 N/A 3154107 unspecified role unspecified role bait bait AU1-tag AU1-tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human n/a 3154108 unspecified role unspecified role prey prey Region 72-235 Region 72-235 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tirap-casp1-3 3154105 N/A 3154107 unspecified role unspecified role prey prey AU1-tag AU1-tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human n/a 3154108 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false casp1-tirap-3 3154106 N/A 3154107 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli n/a 3154108 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false