DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ muto-2007-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Muto S., Senda M., Akai Y., Sato L., Suzuki T., Nagai R., Senda T., Horikoshi M. DIP original experiment: DIP-261166X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity. Muto S., Senda M., Akai Y., Sato L., Suzuki T., Nagai R., Senda T., Horikoshi M. Only protein-protein interactions imex curation q01105-2 Protein SET SET HLA-DR-associated protein II Inhibitor of granzyme A-activated DNase PHAPII Phosphatase 2A inhibitor I2PP2A Template-activating factor I TAF-I beta protein protein human Homo sapiens Human MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD Variant in position: 4:P->Q (in dbSNP:rs1141138). Contains a N6-acetyllysine at position 11. Contains a phosphoserine at position 15. Contains a phosphoserine at position 24. mint set-1 3153866 N/A 3153867 unspecified role unspecified role unspecified role unspecified role Region 1-255 Region 1-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false