DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ okamoto-2007-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Okamoto K., Sagata N. DIP original experiment: DIP-261139X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Okamoto K., Sagata N. Only protein-protein interactions imex curation okamoto-2007-2 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Okamoto K., Sagata N. DIP original experiment: DIP-261135X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Okamoto K., Sagata N. Only protein-protein interactions imex curation okamoto-2007-3 xenla Xenopus laevis (African clawed frog) African clawed frog pull down pull down western blot western blot Immuno blot Immuno blot Okamoto K., Sagata N. DIP original experiment: DIP-261136X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Okamoto K., Sagata N. Only protein-protein interactions imex curation okamoto-2007-4 xenla Xenopus laevis (African clawed frog) African clawed frog pull down pull down predetermined predetermined participant predetermined Okamoto K., Sagata N. DIP original experiment: DIP-261138X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Okamoto K., Sagata N. Only protein-protein interactions imex curation okamoto-2007-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Okamoto K., Sagata N. DIP original experiment: DIP-261137X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Okamoto K., Sagata N. Only protein-protein interactions imex curation q9i9k6_xenla Peptidyl-prolyl cis-trans isomerase pin1.L Pin1 pin1 XELAEV_18018988mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MADEEKLPPGWEKRMSRSSGRVYYFNHMTNASQWERPIAGGKNGQGEPGKVRCSHLLVKHNQSRRPSSWRQDKITRSKDEALELINGYIQKMKSGDEDFESLASQFSDCSSAKAGGDLGSFGKGAMQKPFEDASFALRPGEMSGPVFTDSGIHIILRTE wee1b_xenla Wee1-like protein kinase 1-B wee1-b Zygotic wee1-like protein kinase 1B protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNVQPRNMNVQPRNMNVQPVRHKLFFSDTDEEEEDGHSTGEDSAFQESDSPVSRQREKQEGKPPGGTWEELEEEEGFGSSPIKSPGDFFMSDSPSYRQLAPASPTRSPQGPTSPIPECPGTPPHKTFRKLRLFDTPHTPKSLLSKARGIGSSALRFRGGTLFREAEKAPKPEFVYSTPQVNINPFTPDSLEIQSSAGLCRGRKRALLNDSCGEDMEGSDCELEDEDIRPAKRIPITESNMKSRYATEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGSLSDVISENYRTMQYFTEPELKDLLLQVARGLKYIHSMSLVHMDIKPSNIFISRTTLPNTAVEEADDEECGSGKVIYKIGDLGHVTRVSSPQVEEGDSRFLANEVLQENYTHLAKADIFALALTVWSAAGAEPFPTNGDQWHEIRQGKLPRVPQLLSQEFVDLIKLMISPDPEKRPSSVALVKHSVLLSASRKSAEQLRIELDAEKFKNALLQKELKKAQIAKAAAEERAHFPDRIATRSTTQNNRTTRLIGKKMNRSVSLTIY ccnb2_xenla G2/mitotic-specific cyclin-B2 ccnb2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MATRRAAIPREADNILGGAMRSKVQMNSRRAALGEIGNKVTVRGKPPAVKQSSNAVAKPSKMAATKVANVKTKHVPVKPVVAEAAPKVPSPVPMDVSLKEEELCQAFSDALTSVEDIDADDGGNPQLCSDYVMDIYNYLKQLEVQQSVHPCYLEGKEINERMRAILVDWLVQVHSRFQLLQETLYMGVAIMDRFLQVQPVSRSKLQLVGVTSLLIASKYEEMYTPEVADFVYITDNAYTASQIREMEMIILRLLNFDLGRPLPLHFLRRASKSCSADAEQHTLAKYLMELTLIDYEMVHIKPSEIAAAALCLSQKILGQGTWGTTQHYYTGYTEGDLQLIMKHMAKNITKVNQNLTKHVAVRNKYASSKLMKISTLPQLMAPLITELAASLS cdk2_xenla Cyclin-dependent kinase 2 cdk2 eg1 CDC2 homolog Eg1 protein kinase Cell division protein kinase 2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDGSNISGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTFTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFPKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKVALTHPFFRDVSRPTPHLI wee1_b-pin1-1 3153644 N/A 3153649 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3153650 unspecified role unspecified role bait bait Region 179-191 Region 179-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false pT186 pT186 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false wee1_b-1 3153645 N/A 3153650 putative self putative self unspecified role unspecified role Q8QGV2:p.Lys277Arg K277R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation false false false wee1_b-ccnb2-1 3153646 N/A 3153651 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3153652 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3153650 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false xenla Xenopus laevis (African clawed frog) African clawed frog association association false false false pin1-wee1_b-1 3153647 N/A 3153649 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3153650 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8QGV2:p.Thr186Ala T186A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association false false false wee1_b-wee1_b-1 3153648 N/A 3153650 unspecified role unspecified role bait bait Region 242-595 Region 242-595 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3153650 unspecified role unspecified role prey prey Region 1-241 Region 1-241 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm putative self interaction putative self interaction false false false