DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ garca_alvarez-2007-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined García-Alvarez B., de Cárcer G., Ibañez S., Bragado-Nilsson E., Montoya G. DIP original experiment: DIP-261104X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization. García-Alvarez B., de Cárcer G., Ibañez S., Bragado-Nilsson E., Montoya G. Only protein-protein interactions imex curation garca_alvarez-2007-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined García-Alvarez B., de Cárcer G., Ibañez S., Bragado-Nilsson E., Montoya G. DIP original experiment: DIP-261106X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization. García-Alvarez B., de Cárcer G., Ibañez S., Bragado-Nilsson E., Montoya G. Only protein-protein interactions imex curation garca_alvarez-2007-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined García-Alvarez B., de Cárcer G., Ibañez S., Bragado-Nilsson E., Montoya G. DIP original experiment: DIP-261105X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization. García-Alvarez B., de Cárcer G., Ibañez S., Bragado-Nilsson E., Montoya G. Only protein-protein interactions imex curation mpip3_human M-phase inducer phosphatase 3 CDC25C Dual specificity phosphatase Cdc25C protein protein human Homo sapiens Human MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP plk1_human Serine/threonine-protein kinase PLK1 Polo-like kinase 1 Serine/threonine-protein kinase 13 PLK1 PLK protein protein human Homo sapiens Human MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS cdc25c-plk1-1 3153254 N/A 3153257 unspecified role unspecified role unspecified role unspecified role Region 126-134 Region 126-134 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3153258 unspecified role unspecified role unspecified role unspecified role Region 367-603 Region 367-603 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false cdc25c-plk1-2 3153255 N/A 3153257 unspecified role unspecified role unspecified role unspecified role Region 126-134 Region 126-134 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3153258 unspecified role unspecified role unspecified role unspecified role Region 367-603 Region 367-603 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false cdc25c-plk1-3 3153256 N/A 3153257 unspecified role unspecified role unspecified role unspecified role Region 126-134 Region 126-134 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3153258 unspecified role unspecified role unspecified role unspecified role Region 367-603 Region 367-603 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P53350:p.Trp414Phe W414F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false