DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hsu-2007-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253257X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions imex curation hsu-2007-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253259X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions imex curation hsu-2007-3 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253261X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions imex curation hsu-2007-4 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253258X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions imex curation hsu-2007-5 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253260X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions imex curation rheb_drome GTP-binding protein Rheb homolog Rheb CG1081 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS tctp_drome Translationally-controlled tumor protein homolog CG4800 Tctp protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLITRQGDDIKLEGANASAEEADEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSVPVLMFFKHGLEEEKC tctp_human Translationally-controlled tumor protein TPT1 p23 Histamine-releasing factor Fortilin protein protein human Homo sapiens Human MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC rheb_human GTP-binding protein Rheb Ras homolog enriched in brain RHEB RHEB2 protein protein human Homo sapiens Human MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM rheb-tctp-1 3153222 N/A 3153227 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3153228 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false tpt1-rheb-1 3153223 N/A 3153229 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3153230 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rheb-tpt1-1 3153224 N/A 3153229 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153230 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tctp-rheb-1 3153225 N/A 3153227 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3153228 unspecified role unspecified role bait bait Q9VGS2:p.Glu12Val E12V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rheb-tctp-2 3153226 N/A 3153227 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153228 unspecified role unspecified role unspecified role unspecified role Q9VGS2:p.Glu12Val E12V mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false