DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhou-2007-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. DIP original experiment: DIP-253254X Nature 2007 IMEx Structural definition of a conserved neutralization epitope on HIV-1 gp120. Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. Only protein-protein interactions imex curation zhou-2007-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. DIP original experiment: DIP-253255X Nature 2007 IMEx Structural definition of a conserved neutralization epitope on HIV-1 gp120. Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. Only protein-protein interactions imex curation zhou-2007-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. DIP original experiment: DIP-253256X Nature 2007 IMEx Structural definition of a conserved neutralization epitope on HIV-1 gp120. Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. Only protein-protein interactions imex curation p04578-pro_0000038427 Surface protein gp120 env Env polyprotein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR 33 511 cd4_human T-cell surface glycoprotein CD4 CD4 T-cell surface antigen T4/Leu-3 protein protein human Homo sapiens Human MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI cd4-env-1 3153205 N/A 3153208 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3153209 unspecified role unspecified role unspecified role unspecified role Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd4-env-2 3153206 N/A 3153208 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3153209 unspecified role unspecified role unspecified role unspecified role Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd4-env-3 3153207 N/A 3153208 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3153209 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false