DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ natsume-2007-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253274X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-2 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253272X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253268X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253270X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-5 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253271X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253273X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253269X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation natsume-2007-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. DIP original experiment: DIP-253275X Nature 2007 IMEx Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4. Natsume R., Eitoku M., Akai Y., Sano N., Horikoshi M., Senda T. Only protein-protein interactions imex curation h32_xenla Histone H3.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG asf1a_human Histone chaperone ASF1A Anti-silencing function protein 1 homolog A CCG1-interacting factor A ASF1A CGI-98 HSPC146 protein protein human Homo sapiens Human MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM This sequence has been withdrawn from Uniprot. asf1_yeast Histone chaperone ASF1 ASF1 YJL115W J0755 CIA1 Anti-silencing function protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGVDDEEEEDDEEEDDDEDDEDDEDDDQEDGEGEAEEAAEEEEEEEEKTEDNETNLEEEEEDIENSDGDEEEGEEEVGSVDKNEDGNDKKRRKIEGGSTDIESTPKDAARSTN 186E76075C0B1644 asf1a-h32_xenla-1 3153007 N/A 3153015 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3153016 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3153017 unspecified role unspecified role bait bait Region 1-155 Region 1-155 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false h32_xenla-h4_xenla-1 3153008 N/A 3153015 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false asf1a-h32_xenla-2 3153009 N/A 3153015 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153017 unspecified role unspecified role unspecified role unspecified role Region 1-172 Region 1-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h32_xenla-h4_xenla-2 3153010 N/A 3153015 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false asf1a-h32_xenla-3 3153011 N/A 3153015 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153017 unspecified role unspecified role unspecified role unspecified role Region 1-155 Region 1-155 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false asf1p-h32_xenla-1 3153012 N/A 3153018 unspecified role unspecified role bait bait Region 1-169 Region 1-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P32447:p.Asp54Ala D54A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3153015 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3153016 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false asf1a-h32_xenla-4 3153013 N/A 3153015 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153017 unspecified role unspecified role unspecified role unspecified role Region 1-172 Region 1-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false asf1p-h32_xenla-2 3153014 N/A 3153018 unspecified role unspecified role bait bait Region 1-169 Region 1-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3153015 unspecified role unspecified role prey prey P84233:p.Leu127Ala L127A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P84233:p.[Leu127Ala;Ile131Ala] L127A/I131A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3153016 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false