DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ruch-2007-1 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. DIP original experiment: DIP-66668X Nature structural & molecular biology 2007 IMEx Structure of a VEGF-VEGF receptor complex determined by electron microscopy. Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. Only protein-protein interactions imex curation ruch-2007-2 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. DIP original experiment: DIP-66669X Nature structural & molecular biology 2007 IMEx Structure of a VEGF-VEGF receptor complex determined by electron microscopy. Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. Only protein-protein interactions imex curation ruch-2007-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. DIP original experiment: DIP-66670X Nature structural & molecular biology 2007 IMEx Structure of a VEGF-VEGF receptor complex determined by electron microscopy. Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. Only protein-protein interactions imex curation ruch-2007-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. DIP original experiment: DIP-66671X Nature structural & molecular biology 2007 IMEx Structure of a VEGF-VEGF receptor complex determined by electron microscopy. Ruch C., Skiniotis G., Steinmetz MO., Walz T., Ballmer-Hofer K. Only protein-protein interactions imex curation vgfr2_human Vascular endothelial growth factor receptor 2 Kinase insert domain receptor Protein-tyrosine kinase receptor flk-1 KDR FLK1 Fetal liver kinase 1 VEGFR2 protein protein human Homo sapiens Human MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV q9myv3-3 Vascular endothelial growth factor A VEGFA VEGF Vascular permeability factor protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR vegfh_orfn2 Vascular endothelial growth factor homolog A2R protein protein orfn2 orfn2 OV NZ-2 MKLLVGILVAVCLHQYLLNADSNTKGWSEVLKGSECKPRPIVVPVSETHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEVNVSMELLGASGSGSNGMQRLSFVEHKKCDCRPRFTTTPPTTTRPPRRRR 917C0F6883030C39 kdr-1 3152981 N/A 3152985 unspecified role unspecified role neutral component neutral component 20-764 binding region 20-764 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false 667-753 binding region 667-753 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false kdr-vegfa-3 3152982 N/A 3152986 unspecified role unspecified role neutral component neutral component 26-190 binding region 26-190 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3152985 unspecified role unspecified role neutral component neutral component 20-764 binding region 20-764 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false kdr-vegfa-5 3152983 N/A 3152986 unspecified role unspecified role neutral component neutral component 26-190 binding region 26-190 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3152985 unspecified role unspecified role neutral component neutral component 20-764 binding region 20-764 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false kdr-vegf_e-1 3152984 N/A 3152987 unspecified role unspecified role neutral component neutral component 21-133 binding region 21-133 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3152985 unspecified role unspecified role neutral component neutral component 20-764 binding region 20-764 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false