DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lee-2007-3 in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ. DIP original experiment: DIP-261132X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Escherichia coli enzyme IIANtr regulates the K+ transporter TrkA. Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ. Only protein-protein interactions imex curation lee-2007-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ. DIP original experiment: DIP-261133X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Escherichia coli enzyme IIANtr regulates the K+ transporter TrkA. Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ. Only protein-protein interactions imex curation lee-2007-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ. DIP original experiment: DIP-261134X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Escherichia coli enzyme IIANtr regulates the K+ transporter TrkA. Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ. Only protein-protein interactions imex curation trka_ecoli Trk system potassium uptake protein TrkA trkA b3290 JW3251 protein protein ecoli Escherichia coli (strain K12) MKIIILGAGQVGGTLAENLVGENNDITVVDTNGERLRTLQDKFDLRVVQGHGSHPRVLREAGADDADMLVAVTSSDETNMVACQVAYSLFNTPNRIARIRSPDYVRDADKLFHSDAVPIDHLIAPEQLVIDNIYRLIEYPGALQVVNFAEGKVSLAVVKAYYGGPLIGNALSTMREHMPHIDTRVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQRLEKPYKRIMLVGGGNIGAGLARRLEKDYSVKLIERNQQRAAELAEKLQNTIVFFGDASDQELLAEEHIDQVDLFIAVTNDDEANIMSAMLAKRMGAKKVMVLIQRRAYVDLVQGSVIDIAISPQQATISALLSHVRKADIVGVSSLRRGVAEAIEAVAHGDESTSRVVGRVIDEIKLPPGTIIGAVVRGNDVMIANDNLRIEQGDHVIMFLTDKKFITDVERLFQPSPFFL ptsn_ecoli Nitrogen regulatory protein ptsN rpoP b3204 yhbI Enzyme IIA-NTR Phosphotransferase enzyme IIA component PTS system EIIA component JW3171 protein protein ecoli Escherichia coli (strain K12) MTNNDTTLQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDTEGTPDEA ptsn-trka-1 3152833 N/A 3152836 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3152837 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false ptsn-trka-2 3152834 N/A 3152836 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3152837 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false trka-ptsn-1 3152835 N/A 3152836 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3152837 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false