DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ade-2007-1 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261028X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-2 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261031X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-3 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261034X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-4 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261033X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-5 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261030X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-6 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261029X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-7 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261032X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation ade-2007-8 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ade J., DeYoung BJ., Golstein C., Innes RW. DIP original experiment: DIP-261035X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease. Ade J., DeYoung BJ., Golstein C., Innes RW. Only protein-protein interactions imex curation rps5_arath Disease resistance protein RPS5 RPS5 Resistance to Pseudomonas syringae protein 5 pNd3/pNd10 T28K15.5 At1g12220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFNDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPSSRWRWRET pbs1_arath Serine/threonine-protein kinase PBS1 At5g13160 PBS1 AvrPphB susceptible protein 1 T19L5.120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCFSCFDSSDDEKLNPVDESNHGQKKQSQPTVSNNISGLPSGGEKLSSKTNGGSKRELLLPRDGLGQIAAHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQAYDPSKDDSRRNRDERGARLITRNDDGGGSGSKFDLEGSEKEDSPRETARILNRDINRERAVAEAKMWGESLREKRRQSEQGTSESNSTG avrp3_psesh Cysteine protease avirulence protein AvrPphB avrPph3 protein protein psesh Pseudomonas savastanoi pv. phaseolicola Pseudomonas syringae pv. phaseolicola MKIGTQATSLAVLHNQESHAPQAPIAVRPEPAHAIPEIPLDLAIRPRTRGIHPFLAMTLGDKGCASSSGVSLEDDSHTQVSLSDFSVASRDVNHNNICAGLSTEWLVMSSDGDAESRMDHLDYNGEGQSRGSERHQVYNDALRAALSNDDEAPFFTASTAVIEDAGFSLRREPKTVHASGGSAQLGQTVAHDVAQSGRKHLLSLRFANVQGHAIACSCEGSQFKLFDPNLGEFQSSRSAAPQLIKGLIDHYNSLNYDVACVNEFRVS rps5-pbs1-1 3152491 N/A 3152499 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3152500 unspecified role unspecified role prey prey Q9FE20:p.Gly252Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9FE20:p.Lys115Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false rps5-rps5-1 3152492 N/A 3152499 unspecified role unspecified role prey prey Region 157-512 Region 157-512 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 513-889 Region 513-889 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 157-512 Region 157-512 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false rps5-rps5-2 3152493 N/A 3152499 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 157-512 Region 157-512 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false rps5-rps5-3 3152494 N/A 3152499 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 513-889 Region 513-889 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-512 Region 1-512 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false rps5-rps5-4 3152495 N/A 3152499 unspecified role unspecified role prey prey Region 157-512 Region 157-512 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 513-889 Region 513-889 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false rps5-avrpph3-1 3152496 N/A 3152501 unspecified role unspecified role prey prey nicbe Nicotiana benthamiana N/A 3152500 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana association association false false false rps5-rps5-5 3152497 N/A 3152499 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false rps5-rps5-6 3152498 N/A 3152499 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 513-889 Region 513-889 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana N/A 3152499 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 157-512 Region 157-512 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false